DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment rswl and trmt10a

DIOPT Version :9

Sequence 1:NP_611335.1 Gene:rswl / 37124 FlyBaseID:FBgn0034351 Length:446 Species:Drosophila melanogaster
Sequence 2:NP_001008012.1 Gene:trmt10a / 493374 XenbaseID:XB-GENE-942310 Length:334 Species:Xenopus tropicalis


Alignment Length:338 Identity:81/338 - (23%)
Similarity:137/338 - (40%) Gaps:66/338 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    40 EPQKKFVNPFSQPAPAL----SNDTISENKEERDKRLKVLQLEADIAHQEGRRVPSLEFFKDHHW 100
            ||.|..::|.::...|.    :|..:.||........|        |.....:....:|.|...|
 Frog     8 EPGKCSIDPNTKDLLASQHAGNNTPLQENSSAPRSECK--------AQDAMSKRQMKKFLKQKQW 64

  Fly   101 EHVLTLPTKSARIKYFGYLWQIEMKKEADQRKKAERAKEAERRV-AEMRKE-REENTHIIYGLGH 163
            |....|              :.:.:||..|::|.||..:||..: |..||. |.|          
 Frog    65 EDQREL--------------RKQKRKEKRQKRKLERQAQAEHNIDANSRKRFRHE---------- 105

  Fly   164 TSLFLRIYDTTINHWQNNRLTRAMQFAPKMVLDCSYDEHMNNREATYAAKQLMMCFAENRMNDEP 228
                                  ....|.::::|||:|:.|..|:.....||:..|:||||....|
 Frog   106 ----------------------VQPSALRLIIDCSFDDLMALRDVKKLNKQIRRCYAENRRAVHP 148

  Fly   229 FDLHYCNTQMDSRCMQSLQRYIPTMHNPEFPINLHSKCFTELFPKQNLVYLTPHCREDLVTYNPD 293
            ..|:.  |....:...::..|.....|.: .|::..:.:.:|..|::|||||....|.|...:..
 Frog   149 VQLYL--TSHGGQLKSNMDEYDKGWINWK-DIHIKPEHYKDLIKKEDLVYLTSDSPEVLSELDET 210

  Fly   294 DIYIVGAMVDTMNNEPLSLAKAKRLGLRMARLPLDRYLQWGSGSGKSLTLNQMINIMLDLKKTGD 358
            ..||:|.:||..:::.::..||..||:..|:|||..:::  ..:.|.|.:|.:..|:|...:..:
 Frog   211 KAYIIGGLVDHNHHKGITYKKALELGISHAQLPLGNFVK--MNTRKVLAVNHVFEIILAFLEKKE 273

  Fly   359 WDTALKHV-PRRK 370
            |..|...| |:||
 Frog   274 WKEAFFSVLPQRK 286

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
rswlNP_611335.1 tRNA_m1G_MT 201..370 CDD:294285 46/169 (27%)
trmt10aNP_001008012.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..101 25/114 (22%)
Trm10euk_A 111..286 CDD:349974 50/179 (28%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 290..334
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1545
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.940

Return to query results.
Submit another query.