DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment rswl and CG14618

DIOPT Version :9

Sequence 1:NP_611335.1 Gene:rswl / 37124 FlyBaseID:FBgn0034351 Length:446 Species:Drosophila melanogaster
Sequence 2:NP_608464.1 Gene:CG14618 / 33134 FlyBaseID:FBgn0031189 Length:319 Species:Drosophila melanogaster


Alignment Length:278 Identity:66/278 - (23%)
Similarity:121/278 - (43%) Gaps:42/278 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly   123 EMKKEADQRKKAE--------RAKEAERRVAEMRKEREENTHIIYGLGHTSLFLRIYDTTINHWQ 179
            ::||   |||.||        |.:|.|::..:.|:.:|....:..|.....|            :
  Fly    34 QLKK---QRKLAEFAELRKLRREREREKKKQKRREAKELGLPVRTGPSRKEL------------K 83

  Fly   180 NNRLTRAMQFAPKMVLDCSYDEHMNNREATYAAKQLMMCFAENRMNDEPFDLHYCNTQMDSRCMQ 244
            ..:|....:....:.:|..||:.|..|:.....||.:..:..||.:.:|.:||:...:.:....:
  Fly    84 KRQLADGGKSGLSVAIDLDYDDLMQERDIVKCVKQCLRIYTINRRSPQPGNLHFTGIRRNGHIHE 148

  Fly   245 SLQRYIPTMHNPEFPINLHSKCF-----TELFPKQNLVYLTPHCREDLV--TYNPDDIYIVGAMV 302
            |.::      |..:. |.|.:.:     |::|....|||||  |..|.|  ...|...|::|.:|
  Fly   149 SFKK------NEGWE-NWHVQYYFDRGHTDIFEHSQLVYLT--CESDRVLDKLQPGCTYVIGGLV 204

  Fly   303 DTMNNEPLSLAKAKRLGLRMARLPLDRYLQWGSGSGKSLTLNQMINIMLDLKKTGDWDTA-LKHV 366
            |..:.:.|..::|...||..|||||..::...:.:  .|:...:..::..:....||.|| |:.:
  Fly   205 DHNHFKGLCHSRATSAGLTTARLPLSEHVDMKTRA--VLSTYHVFELLTKVAAGQDWTTAILETI 267

  Fly   367 PRRKVVQNEFQPRREKDH 384
            |.||..:.:...::|.:|
  Fly   268 PMRKGAKAKITDKKEPNH 285

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
rswlNP_611335.1 tRNA_m1G_MT 201..370 CDD:294285 44/176 (25%)
CG14618NP_608464.1 tRNA_m1G_MT 105..271 CDD:280003 44/176 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45450020
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2967
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR13563
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1545
SonicParanoid 00.000 Not matched by this tool.
54.870

Return to query results.
Submit another query.