DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment rswl and Trmt10b

DIOPT Version :9

Sequence 1:NP_611335.1 Gene:rswl / 37124 FlyBaseID:FBgn0034351 Length:446 Species:Drosophila melanogaster
Sequence 2:NP_001013108.1 Gene:Trmt10b / 298081 RGDID:1310735 Length:316 Species:Rattus norvegicus


Alignment Length:366 Identity:83/366 - (22%)
Similarity:147/366 - (40%) Gaps:96/366 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    21 PVRQASKTSSAENLIAGTEEPQKKFVNPFSQPAPALSNDTISENKEERDKRLKVLQLEADIAHQE 85
            |.|..|:.|         ::|         :..|...:|.:||:       ..:||::.:...||
  Rat     9 PQRAGSRAS---------QDP---------EGLPEARDDGLSES-------FLLLQMDVEYDPQE 48

  Fly    86 GRRVPSLEFF-------KDHHWEHVLTLPTKSARIKYFGYLWQIEMKKEADQRKKAERAKEAERR 143
            .||..:...:       |..|||.:::                         .||::|.:|.|||
  Rat    49 KRRPANSAAWSSKNVQRKQRHWERIVS-------------------------SKKSKRKQERERR 88

  Fly   144 VAEMRKEREENTHIIYGLG----HTSLFLRIYDTTINHWQNNRLTRAMQFAPKMVLDCSYDEHMN 204
                :.:|.|:    .|.|    |:..||:..       ...:|..|....|::.:|.|..:||:
  Rat    89 ----KIKRAED----LGNGTCPQHSKRFLKAL-------TKEKLLEAKHSGPRLCVDLSMTQHMS 138

  Fly   205 NREATYAAKQLMMCFAENRMNDEPFDLHYCNTQMDS----RCMQ---SLQRYIPTMHNPEFPINL 262
            .:|.:..|.|:...:..|:....||.::......||    .|::   ....|:..:...:     
  Rat   139 KKELSRLAGQIRRLYGSNKKASRPFWIYLTGFSTDSPLYEECLRMNDGFSAYVLDVTEED----- 198

  Fly   263 HSKCFTELFPKQNLVYLTPHCREDLVTYNPDDIYIVGAMVDTMNNEPLSLAKAKRLGLRMARLPL 327
               ||: |||.:.||||||.....|...:...:||:|.:||....:.::..||:...::.||||:
  Rat   199 ---CFS-LFPLETLVYLTPDSEHPLEDIDLSTVYIIGGLVDESIQKKVTFQKAQEYSVKTARLPI 259

  Fly   328 DRYL----QWGSGSGKSLTLNQMINIMLDLKKTGDWDTALK 364
            ..::    ...:...:.|.:||:.:|:....:|.||..|||
  Rat   260 QEHMIRCQNEKNFHSEILAINQVFDILSAYLETRDWPEALK 300

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
rswlNP_611335.1 tRNA_m1G_MT 201..370 CDD:294285 45/175 (26%)
Trmt10bNP_001013108.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..30 6/38 (16%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 42..98 17/88 (19%)
tRNA_m1G_MT 135..307 CDD:294285 45/175 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2967
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.