DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment rswl and trm10

DIOPT Version :9

Sequence 1:NP_611335.1 Gene:rswl / 37124 FlyBaseID:FBgn0034351 Length:446 Species:Drosophila melanogaster
Sequence 2:NP_593764.1 Gene:trm10 / 2543319 PomBaseID:SPAC6B12.09 Length:304 Species:Schizosaccharomyces pombe


Alignment Length:371 Identity:91/371 - (24%)
Similarity:158/371 - (42%) Gaps:93/371 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    57 SNDTISENKEERDKRLKVLQLEADIAHQEGRRVPSLEFFKDHHWEHVLTLPTKSA--RIKYFGYL 119
            :.|.:...|::.:..      |||::..|.:..|.|               :|||  |:|.    
pombe     3 NKDALDIGKDDTNTS------EADVSKNETQEQPVL---------------SKSALKRLKR---- 42

  Fly   120 WQIEMKKEADQRKKAERAKEAERRVAEMRKEREENTHIIYGLGHTSLFLRIYDTTINHWQNNRLT 184
               :.:.:|.:.|:||..:|.:|...|.||.:.|...::     .|...||           ||.
pombe    43 ---QQEWDAGREKRAEMRREKKRLRKEERKRKIEAGEVV-----KSQKKRI-----------RLG 88

  Fly   185 RAMQFAPKMVLDCSYDEHMNNREATYAAKQLMMCFAENRMNDEPFDLHYCN------TQMD---S 240
            :.:..:.::||||::|:.||::|.....:|:..|.:.||....|.:|...|      |:.|   .
pombe    89 KVVPSSIRIVLDCAFDDLMNDKEINSLCQQVTRCHSANRTALHPVELFATNFGGRLKTRQDFVLK 153

  Fly   241 RCMQSLQRYIPTMHNPEFPINLHSKCFTELF--PKQNLVYLTPHCREDLVTYNPDDIYIVGAMVD 303
            ....:.:||.||           :|.:.|.|  .|:.||||:......:...:.|.|||:||:||
pombe   154 GQQNNWKRYNPT-----------TKSYLEEFESQKEKLVYLSADSDNTITELDEDKIYIIGAIVD 207

  Fly   304 TMNNEPLSLAKAKRLGLRMARLPLDRYLQWGSGSGKSLTLNQMINIMLDLKKTGDWDTA-LKHVP 367
            ....:.|...||...|::.|:||:|.|::  ....|.||:||:..|:....:..||:.| ::.:|
pombe   208 KNRYKNLCQNKASEQGIKTAKLPIDEYIK--ITDRKILTVNQVFEILSLWLEYRDWEKAFMEVIP 270

  Fly   368 RRKVVQNEFQPRREKDHWSTGTRARKLNMRIDHLFDFDENRRQATS 413
            :||.:.                      ::.|..||..|:.|..::
pombe   271 KRKGIL----------------------LKSDESFDVSEDTRSQSN 294

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
rswlNP_611335.1 tRNA_m1G_MT 201..370 CDD:294285 51/180 (28%)
trm10NP_593764.1 tRNA_m1G_MT 105..273 CDD:280003 51/180 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2967
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR13563
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1545
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.940

Return to query results.
Submit another query.