DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment rswl and C56G2.3

DIOPT Version :9

Sequence 1:NP_611335.1 Gene:rswl / 37124 FlyBaseID:FBgn0034351 Length:446 Species:Drosophila melanogaster
Sequence 2:NP_001367605.1 Gene:C56G2.3 / 183866 WormBaseID:WBGene00016978 Length:405 Species:Caenorhabditis elegans


Alignment Length:439 Identity:108/439 - (24%)
Similarity:188/439 - (42%) Gaps:73/439 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MLKHFARWRLGSQLLKGCAAPVRQASKTSSAENLIAGTEEPQKKFVNPFSQPAPALSNDTISENK 65
            :.:.|||..|..:.:  |....|....:|::.:..|..||.:..|.:  .:|:.........|.|
 Worm     4 LTRFFARALLPQRHV--CYGQARALGSSSTSSSATAPVEEEEVSFES--LKPSKVFERSLTKELK 64

  Fly    66 EERDKRLKVLQLEADIAHQEGRRVPSLEFFKDHHWEHVLTLPTKSARIKYFGYLWQIEMKKEADQ 130
            |:.:..||    |.:|....|:.||:.  ..|..|:..|...:.:.:|.|:.||      ...|:
 Worm    65 EKYETALK----EFEIFVYMGKYVPTR--MSDEAWKQTLICESINDKIGYWEYL------AVTDK 117

  Fly   131 RKKAERAKEAERRVAEMRKEREENTHIIY---GLGHTSLFLRIYDT------TINHWQNNRLTRA 186
            |:::.  .:|:...||..|:..|....||   |:|:.....::...      .:|:.:.:::..|
 Worm   118 RRRSR--NKAQSSGAENYKKVLEEQQRIYTAGGMGYGPEMYQVISNPMRNQKRVNNIEGSKIFAA 180

  Fly   187 MQF-APKMVLDCSYDEHMNNREATYAAKQLMMCFAENRMNDEPFDLHYCNTQMDSRCMQSLQR-- 248
            |.. ||::.||..|.|.||.|::.....|:....:||.....||.|.:.|:.......|.|.:  
 Worm   181 MNSGAPRIALDIQYVEEMNKRDSGELGNQMQYTISENFSAKSPFVLDFVNSPSKEFLEQWLSKSV 245

  Fly   249 ------YIPTMHNPEFPINLHSKCFTELFPKQ-NLVYLTPHCREDLVTYNPDDIYIVGAMVDTMN 306
                  ||.....|:|    .:|...|.:.|. |.:|::.:.|:  |...|....::|..| ||.
 Worm   246 GYYTGNYINQTILPDF----STKGIKEFYGKSANTIYISSNARD--VLDGPLTADVIGICV-TMG 303

  Fly   307 NEPLSLAKAKRLGLRMARLPLDRYLQWGSGSGKSLTLNQMINIMLDL-KKTGDWDTAL-KHVPRR 369
            .:..:|:.|:|..:|..|||:.||::|.||. :.|....::|::.:: ...|||..|| .::.:|
 Worm   304 RKREALSAARRANIRAYRLPIHRYVKWKSGP-QYLPFPNIMNVLREVYMNGGDWSRALHNNISKR 367

  Fly   370 KVV------QNEFQPRREKDHWSTGTRARKLNMRIDHLFDFDENRRQAT 412
            .:|      |.:.|..|.        |||            :|.||:.|
 Worm   368 HLVNADDDEQKKMQMLRR--------RAR------------EEERRELT 396

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
rswlNP_611335.1 tRNA_m1G_MT 201..370 CDD:294285 48/179 (27%)
C56G2.3NP_001367605.1 SPOUT_MTase 186..367 CDD:422952 52/188 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160159804
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2967
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1569668at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR13563
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
54.850

Return to query results.
Submit another query.