DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment rswl and F25H8.1

DIOPT Version :9

Sequence 1:NP_611335.1 Gene:rswl / 37124 FlyBaseID:FBgn0034351 Length:446 Species:Drosophila melanogaster
Sequence 2:NP_501789.1 Gene:F25H8.1 / 177847 WormBaseID:WBGene00009131 Length:297 Species:Caenorhabditis elegans


Alignment Length:362 Identity:85/362 - (23%)
Similarity:142/362 - (39%) Gaps:87/362 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    56 LSNDTISENKEERDKRLKVLQLEADIAHQ-EGRRVPSLEFFKDHHWEHVLTLPTKSARIKYFGYL 119
            :|.:||.             :.|.::.|| :.:.||.             .:..|..|.:.:...
 Worm     1 MSEETIE-------------KFEDNVEHQNQDQPVPE-------------GMSKKQLRRQKYKVK 39

  Fly   120 WQIEMKKEADQRKKAERAKEAERRVA--------EMRKEREENTHIIYGLGHTSLFLRIYDTTIN 176
            |  |.||..  ::.|||.::.|:|.|        ::||.::..|..                   
 Worm    40 W--EEKKLV--KRAAERIRKKEKRAALKESGDLSKLRKRKDFRTMA------------------- 81

  Fly   177 HWQNNRLTRAMQFAPKMVLDCSYDEHMNNREATYAAKQLMMCFAENRMNDEPFDLHYCNTQMDSR 241
              |:|...|       :.||.|:|:.|..::.....:|:..|:..||.:.:||..|.......||
 Worm    82 --QSNSKQR-------IALDMSFDDLMIEKDQKRTVQQIGWCYTANRHSPDPFQFHVVGFDGPSR 137

  Fly   242 CMQSLQRYIPTMHNPEFPINLHSKCFTELFPKQNLVYLTPHCREDLVTYNPDDIYIVGAMVDTMN 306
                 :.|....||....|:||.:....||..:.:||||......|...:...:|::|.:||..:
 Worm   138 -----KIYDGNEHNLNQDIHLHQEKLENLFKPEEIVYLTSESENVLSDLDDTKVYVIGGIVDHNS 197

  Fly   307 NEPLSLAKAKRLGLRMARLPLDRYLQWGSGSGKSLTLNQMINIMLDLKKTGDW-DTALKHVPRRK 370
            .:.|....|:..|...|:||||.:|.  ..|.:.||:||:..|::......:| |..|..:|.||
 Worm   198 QKGLCYRIAQEKGFGHAKLPLDEHLL--MKSRRVLTINQVYEILVHYSVHKNWKDALLSIIPERK 260

  Fly   371 VVQNEFQPRREK------------DHWSTGTRARKLN 395
            ..|.:.:...||            :...|.|.:.|:|
 Worm   261 NAQLKEEVVEEKPESLEEIGKLDTESTDTATGSPKIN 297

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
rswlNP_611335.1 tRNA_m1G_MT 201..370 CDD:294285 46/169 (27%)
F25H8.1NP_501789.1 Trm10euk_A 87..260 CDD:349974 51/186 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1545
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.940

Return to query results.
Submit another query.