DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment rswl and TRMT10B

DIOPT Version :9

Sequence 1:NP_611335.1 Gene:rswl / 37124 FlyBaseID:FBgn0034351 Length:446 Species:Drosophila melanogaster
Sequence 2:XP_011516037.1 Gene:TRMT10B / 158234 HGNCID:26454 Length:329 Species:Homo sapiens


Alignment Length:362 Identity:89/362 - (24%)
Similarity:149/362 - (41%) Gaps:76/362 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    24 QASKTSSAENLIAGTEEPQKKFVNPFSQPAPALSNDTISENKEERDKRLKVLQLEADIAHQEG-- 86
            :..:|.|.:..:.|:.:   |..:|..|....:..:|..:...|   ..::||::|:...|||  
Human     7 KGQRTKSMDWKLEGSTQ---KVESPVLQGQEGILEETGEDGLPE---GFQLLQIDAEGECQEGEI 65

  Fly    87 ----------RRVPSLEFFKDHHWEHVLTLPTKSARIKYFGYLWQIEMKKEADQRKKAERAKEAE 141
                      :.|..    |..|||.::.                         .||::|.:|.|
Human    66 LATGSTAWCSKNVQR----KQRHWEKIVA-------------------------AKKSKRKQEKE 101

  Fly   142 RRVAEMRKEREENTHIIYGLGHTSLFLRIYDTTINHWQNNRLTRAMQFAPKMVLDCSYDEHMNNR 206
            ||.|    .|.||..|.  ..|:..|||..       ..::|..|....|::.:|.|...:|:.:
Human   102 RRKA----NRAENPGIC--PQHSKRFLRAL-------TKDKLLEAKHSGPRLCIDLSMTHYMSKK 153

  Fly   207 EATYAAKQLMMCFAENRMNDEPFDLHYCNTQMDSRCMQSLQRYIPTMHNPEFPINL----HSKCF 267
            |.:..|.|:...:..|:..|.||.:.......||...:...|.     |..|...|    ...||
Human   154 ELSRLAGQIRRLYGSNKKADRPFWICLTGFTTDSPLYEECVRM-----NDGFSSYLLDITEEDCF 213

  Fly   268 TELFPKQNLVYLTPHCREDLVTYNPDDIYIVGAMVDTMNNEPLSLAKAKRLGLRMARLPLDRYLQ 332
            : |||.:.||||||.....|...:.:.:||:|.:||....:.::..||:...::.||||:..|:.
Human   214 S-LFPLETLVYLTPDSEHALEDVDLNKVYILGGLVDESIQKKVTFQKAREYSVKTARLPIQEYMV 277

  Fly   333 WGSGSGKS-----LTLNQMINIMLDLKKTGDWDTALK 364
             .:.:||:     |.:||:.:|:....:|.:|..|||
Human   278 -RNQNGKNYHSEILAINQVFDILSTYLETHNWPEALK 313

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
rswlNP_611335.1 tRNA_m1G_MT 201..370 CDD:294285 49/173 (28%)
TRMT10BXP_011516037.1 tRNA_m1G_MT 149..320 CDD:294285 49/172 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2967
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.