DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Prp19 and CG9799

DIOPT Version :9

Sequence 1:NP_523783.1 Gene:Prp19 / 37123 FlyBaseID:FBgn0261119 Length:505 Species:Drosophila melanogaster
Sequence 2:NP_650284.2 Gene:CG9799 / 41647 FlyBaseID:FBgn0038146 Length:922 Species:Drosophila melanogaster


Alignment Length:333 Identity:71/333 - (21%)
Similarity:133/333 - (39%) Gaps:70/333 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly   171 AEVIQKLQDKATVLTQERKKRGR---------TVPEDLVTTDQVKNFLTVASHPGLHSASVPGIL 226
            :|.:.|...:||...:..||:.|         .:.|....|.:.|.:..:|:   :|:    |::
  Fly   366 SESLNKSMGRATYNPKATKKKNRFEHDKFGMPPILEFTSDTAREKEWDNIAA---IHA----GVI 423

  Fly   227 ALDINS------ADHSKILTGGNDKNATVFNKDTEQMVAILKGHTKKITKVIYHPNEDTVITGSP 285
            .....|      .:|..:.....:.|.|.|..:|..:|....|              :.||.|..
  Fly   424 QTTTWSFGKNRMGEHRLVPKQFQNSNRTNFQNETTCIVLTHCG--------------NFVIIGYS 474

  Fly   286 DMNIRIWHVPTSQTQLLLR------CHEGPVTGLSLHPTGDYLLSTSSD---KHWAFSDIRTGRL 341
            ..:|..:::.:.    |.|      .|:..|.||:.......::|..|:   |.|:|.    |: 
  Fly   475 SGDIERFNIQSG----LHRATYGSPAHKMAVRGLASDNLNQTVISGCSEGLLKFWSFK----GK- 530

  Fly   342 LTKVIDTAEV--GLTTAQFHPDGLIFGTGTVDSQVKIWDLKEQSNVANFPGHTGPISAISFSENG 404
            :.|.:.|..:  |:...:.|.:..:...|....::.:.|:..:..|..|.|||..::.::||.:.
  Fly   531 VDKPLATLRLADGIALIRQHRESSMLAIGLETFKIFVVDMHTRVIVRKFVGHTAKLNDLTFSPDS 595

  Fly   405 YYLATAADDACVKLWDLRKLKNFKTIQLDDGYEVKDLCFDQS----GTYLAIAGSD-VRVYLCKQ 464
            .:|.|||.|:.:|:||:      .:..:.|.:.|:..|...|    |.:||.|... :.:||   
  Fly   596 RWLITAAMDSTIKVWDI------PSSYMVDHFRVEAPCVSLSMSPNGDFLATAHVGLLGIYL--- 651

  Fly   465 WQELKVFN 472
            |....:||
  Fly   652 WANKTLFN 659

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Prp19NP_523783.1 Ubox 2..68 CDD:128780
Prp19 69..132 CDD:285771
WD40 210..503 CDD:238121 61/285 (21%)
WD40 <225..505 CDD:225201 58/270 (21%)
WD40 repeat 269..305 CDD:293791 6/41 (15%)
WD40 repeat 310..345 CDD:293791 9/37 (24%)
WD40 repeat 354..389 CDD:293791 4/34 (12%)
WD40 repeat 395..431 CDD:293791 10/35 (29%)
WD40 repeat 438..484 CDD:293791 12/40 (30%)
CG9799NP_650284.2 WD40 repeat 84..116 CDD:293791
WD40 111..372 CDD:295369 1/5 (20%)
WD40 144..621 CDD:225201 59/290 (20%)
WD40 repeat 162..201 CDD:293791
WD40 repeat 206..242 CDD:293791
WD40 repeat 249..285 CDD:293791
WD40 repeat 291..331 CDD:293791
WD40 repeat 337..364 CDD:293791
WD40 repeat 408..447 CDD:293791 6/45 (13%)
WD40 458..652 CDD:295369 49/225 (22%)
WD40 repeat 458..496 CDD:293791 8/55 (15%)
WD40 repeat 502..540 CDD:293791 10/42 (24%)
WD40 repeat 545..580 CDD:293791 4/34 (12%)
WD40 repeat 587..622 CDD:293791 11/40 (28%)
Utp21 698..918 CDD:282098
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45470269
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.