DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Prp19 and CG9123

DIOPT Version :10

Sequence 1:NP_523783.1 Gene:Prp19 / 37123 FlyBaseID:FBgn0261119 Length:505 Species:Drosophila melanogaster
Sequence 2:NP_573018.1 Gene:CG9123 / 32462 FlyBaseID:FBgn0030629 Length:434 Species:Drosophila melanogaster


Alignment Length:114 Identity:28/114 - (24%)
Similarity:43/114 - (37%) Gaps:36/114 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly   531 SDKVTVTDNGFLLLPQNHPEYLTLIRLQLENQELVNWKAQLQARIQTERNEIVKMKKLLVADGCA 595
            :|...|.|:.||.|     ..|.|......|:..:.|..::.|.:..    :|.::.::      
  Fly    44 TDVSRVFDSFFLFL-----NLLLLFGAVWNNEPALIWSQRIIAVVVV----LVVIQFMI------ 93

  Fly   596 TNAPASLDASLTAS-----------EEYDK-------LMAHYVKENALL 626
              .|. |.|||.||           .||:|       |:|.||.|..|:
  Fly    94 --WPV-LFASLAASGRLKLENVLSKTEYEKEEMFQKGLLAGYVAEFVLV 139

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Prp19NP_523783.1 RING-Ubox_PRP19 3..56 CDD:438318
Prp19 69..133 CDD:400774
WD40 210..503 CDD:238121
WD40 repeat 269..305 CDD:293791
WD40 repeat 310..345 CDD:293791
WD40 repeat 354..389 CDD:293791
WD40 repeat 395..431 CDD:293791
WD40 repeat 438..484 CDD:293791
CG9123NP_573018.1 WD40 repeat 50..85 CDD:293791 9/39 (23%)
WD40 <59..289 CDD:441893 22/94 (23%)
WD40 repeat 91..129 CDD:293791 10/46 (22%)
WD40 repeat 134..170 CDD:293791 2/6 (33%)
WD40 repeat 178..216 CDD:293791
WD40 repeat 222..257 CDD:293791
WD40 repeat 264..288 CDD:293791
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.