DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5189 and lamtor2

DIOPT Version :9

Sequence 1:NP_001137699.1 Gene:CG5189 / 37122 FlyBaseID:FBgn0034350 Length:125 Species:Drosophila melanogaster
Sequence 2:NP_001005040.1 Gene:lamtor2 / 448570 XenbaseID:XB-GENE-992364 Length:125 Species:Xenopus tropicalis


Alignment Length:125 Identity:86/125 - (68%)
Similarity:106/125 - (84%) Gaps:0/125 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MLKPKALTQVLSQANTGGVENTLLLSQEGALLAYSGYGDKDARITAAIASNIWAAYEKHGRNAFR 65
            ||:||||||||||||||||::||||:.||:|||||||||.|||:||||||||||||:|:|..||.
 Frog     1 MLRPKALTQVLSQANTGGVQSTLLLNNEGSLLAYSGYGDTDARVTAAIASNIWAAYDKNGHQAFN 65

  Fly    66 EGRLTFVLIDCENGHVAITQVASVLLCLYAKQTVGLGLLKQKAMSLASYLERPLKQISAS 125
            |..|.|:|:||..|.||||:|:::|||:|||:|||.|:||.||.:|..|||..|.|:|:|
 Frog    66 EDNLKFILMDCMEGRVAITRVSNLLLCMYAKETVGFGMLKAKAQALVYYLEESLNQVSSS 125

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5189NP_001137699.1 Robl_LC7 5..95 CDD:367422 64/89 (72%)
lamtor2NP_001005040.1 Robl_LC7 8..95 CDD:308728 61/86 (71%)
Required for location at endosomes. /evidence=ECO:0000250 57..70 5/12 (42%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 133 1.000 Domainoid score I5050
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H8518
Inparanoid 1 1.050 179 1.000 Inparanoid score I3908
OMA 1 1.010 - - QHG56102
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0006237
OrthoInspector 1 1.000 - - oto104366
Panther 1 1.100 - - O PTHR13323
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X5185
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
1010.070

Return to query results.
Submit another query.