DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5189 and Lamtor2

DIOPT Version :9

Sequence 1:NP_001137699.1 Gene:CG5189 / 37122 FlyBaseID:FBgn0034350 Length:125 Species:Drosophila melanogaster
Sequence 2:XP_008759356.1 Gene:Lamtor2 / 295234 RGDID:1562501 Length:151 Species:Rattus norvegicus


Alignment Length:151 Identity:87/151 - (57%)
Similarity:108/151 - (71%) Gaps:26/151 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MLKPKALTQVLSQANTGGVENTLLLSQEGALLAYSGYGDKDARITAAIASNIWAAYEKHGRNAFR 65
            ||:||||||||||||||||::||||:.||:|||||||||.|||:||||||||||||:::|..||.
  Rat     1 MLRPKALTQVLSQANTGGVQSTLLLNNEGSLLAYSGYGDTDARVTAAIASNIWAAYDRNGNQAFN 65

  Fly    66 EGRLTFVLIDC--------------------------ENGHVAITQVASVLLCLYAKQTVGLGLL 104
            |..|.|:|:||                          :.|.||||:||::|||:|||:|||.|:|
  Rat    66 EDSLKFILMDCMDQRNPGEGRNQGCQAECPSVLCHSHQEGRVAITRVANLLLCMYAKETVGFGML 130

  Fly   105 KQKAMSLASYLERPLKQISAS 125
            |.||.:|..|||.||.|::||
  Rat   131 KAKAQALVQYLEEPLTQVAAS 151

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5189NP_001137699.1 Robl_LC7 5..95 CDD:367422 64/115 (56%)
Lamtor2XP_008759356.1 Robl_LC7 5..>78 CDD:397386 54/72 (75%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166353705
Domainoid 1 1.000 132 1.000 Domainoid score I4998
eggNOG 1 0.900 - - E1_KOG4107
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H8518
Inparanoid 1 1.050 182 1.000 Inparanoid score I3878
OMA 1 1.010 - - QHG56102
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0006237
OrthoInspector 1 1.000 - - oto97679
orthoMCL 1 0.900 - - OOG6_105749
Panther 1 1.100 - - LDO PTHR13323
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X5185
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
1514.760

Return to query results.
Submit another query.