DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5189 and LAMTOR2

DIOPT Version :9

Sequence 1:NP_001137699.1 Gene:CG5189 / 37122 FlyBaseID:FBgn0034350 Length:125 Species:Drosophila melanogaster
Sequence 2:NP_054736.1 Gene:LAMTOR2 / 28956 HGNCID:29796 Length:125 Species:Homo sapiens


Alignment Length:125 Identity:87/125 - (69%)
Similarity:107/125 - (85%) Gaps:0/125 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MLKPKALTQVLSQANTGGVENTLLLSQEGALLAYSGYGDKDARITAAIASNIWAAYEKHGRNAFR 65
            ||:||||||||||||||||::||||:.||:|||||||||.|||:||||||||||||:::|..||.
Human     1 MLRPKALTQVLSQANTGGVQSTLLLNNEGSLLAYSGYGDTDARVTAAIASNIWAAYDRNGNQAFN 65

  Fly    66 EGRLTFVLIDCENGHVAITQVASVLLCLYAKQTVGLGLLKQKAMSLASYLERPLKQISAS 125
            |..|.|:|:||..|.||||:||::|||:|||:|||.|:||.||.:|..|||.||.|::||
Human    66 EDNLKFILMDCMEGRVAITRVANLLLCMYAKETVGFGMLKAKAQALVQYLEEPLTQVAAS 125

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5189NP_001137699.1 Robl_LC7 5..95 CDD:367422 64/89 (72%)
LAMTOR2NP_054736.1 Robl_LC7 5..95 CDD:397386 64/89 (72%)
Required for location at endosomes. /evidence=ECO:0000250 57..70 4/12 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165159654
Domainoid 1 1.000 133 1.000 Domainoid score I5090
eggNOG 1 0.900 - - E1_KOG4107
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H8518
Inparanoid 1 1.050 183 1.000 Inparanoid score I3978
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG56102
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0006237
OrthoInspector 1 1.000 - - oto90565
orthoMCL 1 0.900 - - OOG6_105749
Panther 1 1.100 - - LDO PTHR13323
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2623
SonicParanoid 1 1.000 - - X5185
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
1514.790

Return to query results.
Submit another query.