DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5189 and SPBC1778.05c

DIOPT Version :9

Sequence 1:NP_001137699.1 Gene:CG5189 / 37122 FlyBaseID:FBgn0034350 Length:125 Species:Drosophila melanogaster
Sequence 2:NP_596288.2 Gene:SPBC1778.05c / 2540131 PomBaseID:SPBC1778.05c Length:160 Species:Schizosaccharomyces pombe


Alignment Length:149 Identity:37/149 - (24%)
Similarity:63/149 - (42%) Gaps:39/149 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MLKPKALTQVLSQANTGGVENTLLLSQEGALLAYSGYGD-----------KDARITAAIASNIWA 54
            |:|||.|:.::.||....|.:.::.:..|:||||..:.|           |..|..||:|.|:::
pombe     1 MIKPKKLSSLMKQAVEETVPSIMVFTTTGSLLAYVSFEDPKDGLKRLDLAKRVRSIAALAGNMYS 65

  Fly    55 AYE----------------KHGRNAFREGRLTFVLIDCENGHVAITQVA--SVLLCLYAKQTVGL 101
            .|.                .|.|:...|     .:|:.|.|.:.|..::  .....||:|..:.|
pombe    66 LYTATNPSPLVAESTDDVIAHQRDVLFE-----TIIEFERGKLLIAAISIDGAEDKLYSKDPLLL 125

  Fly   102 GLL-----KQKAMSLASYL 115
            |::     |:..|.:.|.|
pombe   126 GIVGTENAKEGMMQIKSEL 144

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5189NP_001137699.1 Robl_LC7 5..95 CDD:367422 26/118 (22%)
SPBC1778.05cNP_596288.2 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0006237
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_105749
Panther 1 1.100 - - LDO PTHR13323
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.910

Return to query results.
Submit another query.