DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5189 and lmtr-2

DIOPT Version :9

Sequence 1:NP_001137699.1 Gene:CG5189 / 37122 FlyBaseID:FBgn0034350 Length:125 Species:Drosophila melanogaster
Sequence 2:NP_505061.1 Gene:lmtr-2 / 179177 WormBaseID:WBGene00022402 Length:124 Species:Caenorhabditis elegans


Alignment Length:126 Identity:49/126 - (38%)
Similarity:77/126 - (61%) Gaps:9/126 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MLKPKALTQVLSQANTGGVENTLLLSQEGALLAYSGYGDK--DARITAAIASNIWAAYEKHGRNA 63
            |||.|||..||.|.||.||:.:.|.::||.||||.|...|  .:.:::|:.:::|||.|:     
 Worm     1 MLKQKALVDVLGQVNTSGVDGSWLFNKEGLLLAYVGSEQKAVASNVSSALIASVWAALER----- 60

  Fly    64 FREGRLTFVLIDCENGHVAITQVA-SVLLCLYAKQTVGLGLLKQKAMSLASYLERPLKQIS 123
             |...|...::..|||.:..|.|| ::||.:.|.::..||:::.|..:||:|||:|:..||
 Worm    61 -RANDLKETILVLENGVIGCTLVARTMLLAVKADKSADLGMVRAKLHTLAAYLEQPILSIS 120

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5189NP_001137699.1 Robl_LC7 5..95 CDD:367422 34/92 (37%)
lmtr-2NP_505061.1 Robl_LC7 9..92 CDD:281277 31/88 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160167189
Domainoid 1 1.000 47 1.000 Domainoid score I8152
eggNOG 1 0.900 - - E1_KOG4107
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 81 1.000 Inparanoid score I3790
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG56102
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0006237
OrthoInspector 1 1.000 - - oto20188
orthoMCL 1 0.900 - - OOG6_105749
Panther 1 1.100 - - LDO PTHR13323
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2623
SonicParanoid 1 1.000 - - X5185
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
1413.830

Return to query results.
Submit another query.