| Sequence 1: | NP_523782.1 | Gene: | slim / 37121 | FlyBaseID: | FBgn0261477 | Length: | 609 | Species: | Drosophila melanogaster |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | NP_689579.3 | Gene: | KLHDC9 / 126823 | HGNCID: | 28489 | Length: | 349 | Species: | Homo sapiens |
| Alignment Length: | 314 | Identity: | 64/314 - (20%) |
|---|---|---|---|
| Similarity: | 93/314 - (29%) | Gaps: | 111/314 - (35%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 283 GGTGYPFGVSCSNDCYVYRTASAGATPGVDRLQVKGDLPTAQYGPGIVIHKHFLYTIGGTTGFDY 347
Fly 348 TCDVYRLDLRTGIWE---------------------------------------NVYISRPEMRD 373
Fly 374 DPEGR---YRHEVVYDGKHIFVLGGGTS--------HSVYDLQRIPAYNLE----ANCWDYFETY 423
Fly 424 PD-----------QRAADADDGNRGYPKPRKCFSCVQHQSSTGDIEAFITGG--LQGDFSTYFSD 475
Fly 476 IWKLNLRTKHWYRIETAILPRPLYFHSAAHSDNG--------C-----MYVFGG 516 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| slim | NP_523782.1 | KELCH repeat | 203..263 | CDD:276965 | |
| KELCH repeat | 267..321 | CDD:276965 | 11/37 (30%) | ||
| KELCH repeat | 324..364 | CDD:276965 | 10/78 (13%) | ||
| Kelch_1 | 325..372 | CDD:279660 | 12/85 (14%) | ||
| Kelch_4 | 441..492 | CDD:290154 | 12/52 (23%) | ||
| KELCH repeat | 442..495 | CDD:276965 | 12/54 (22%) | ||
| KLHDC9 | NP_689579.3 | KELCH repeat | 28..76 | CDD:276965 | 10/35 (29%) |
| Kelch_3 | 37..85 | CDD:290151 | 12/45 (27%) | ||
| Kelch 1 | 39..89 | 12/49 (24%) | |||
| Kelch_1 | 78..118 | CDD:279660 | 9/40 (23%) | ||
| KELCH repeat | 79..118 | CDD:276965 | 8/39 (21%) | ||
| Kelch 2 | 91..137 | 10/45 (22%) | |||
| KELCH repeat | 187..239 | CDD:276965 | 7/51 (14%) | ||
| KELCH repeat | 259..311 | CDD:276965 | 17/68 (25%) | ||
| Kelch 3 | 325..349 | 3/7 (43%) | |||
| Blue background indicates that the domain is not in the aligned region. | |||||
| Tool | Simple Score | Weighted Score | Original Tool Information | |||
|---|---|---|---|---|---|---|
| BLAST Result | Score | Score Type | Cluster ID | |||
| Compara | 0 | 0.000 | Not matched by this tool. | |||
| Domainoid | 0 | 0.000 | Not matched by this tool. | |||
| eggNOG | 1 | 0.900 | - | - | E1_KOG0379 | |
| Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
| Homologene | 0 | 0.000 | Not matched by this tool. | |||
| Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
| Isobase | 0 | 0.000 | Not matched by this tool. | |||
| OMA | 0 | 0.000 | Not matched by this tool. | |||
| OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
| OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
| OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
| orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
| Panther | 0 | 0.000 | Not matched by this tool. | |||
| Phylome | 0 | 0.000 | Not matched by this tool. | |||
| RoundUp | 0 | 0.000 | Not matched by this tool. | |||
| SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
| SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
| TreeFam | 0 | 0.000 | Not matched by this tool. | |||
| User_Submission | 0 | 0.000 | Not matched by this tool. | |||
| 1 | 0.900 | |||||