DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment slim and KLHDC1

DIOPT Version :9

Sequence 1:NP_523782.1 Gene:slim / 37121 FlyBaseID:FBgn0261477 Length:609 Species:Drosophila melanogaster
Sequence 2:NP_751943.1 Gene:KLHDC1 / 122773 HGNCID:19836 Length:406 Species:Homo sapiens


Alignment Length:414 Identity:96/414 - (23%)
Similarity:148/414 - (35%) Gaps:95/414 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly   203 RSGHRIIASNSHLYSLGGYNPRSAMSASRHGRCLLFQELWSYNFATRTWRLELNAGNAANMPVEL 267
            ||||..:...:.||..|||     :|...:...|...|:|:|:..:..||:.|..|   .:|..:
Human    13 RSGHCAVVDGNFLYVWGGY-----VSIEDNEVYLPNDEIWTYDIDSGLWRMHLMEG---ELPASM 69

  Fly   268 ASNALTIHNNVLISHGG---TGYPFGVSCSNDCYVYRTASAGATPGVDRL-QVKGDLPTAQYGPG 328
            :.:.....|..|...||   .||      ||..|.....:...|...::: ..:|..||.:....
Human    70 SGSCGACINGKLYIFGGYDDKGY------SNRLYFVNLRTRDETYIWEKITDFEGQPPTPRDKLS 128

  Fly   329 IVIHKHFLYTIGGTTGFDYTC---------------------------DVYRLDLRTGIWENVYI 366
            ..::|..|...||     |.|                           ||:..|.:|..|     
Human   129 CWVYKDRLIYFGG-----YGCRRHSELQDCFDVHDASWEEQIFWGWHNDVHIFDTKTQTW----- 183

  Fly   367 SRPEMRD--DPEGRYRHEVVYDGKHIFVLGGGTSHS-VYDLQRIPAYNLEANCWDYFETYPDQRA 428
            .:||::.  .|:.|..|.....|...::.||....: :.||..:   ||:...|....|.     
Human   184 FQPEIKGGVPPQPRAAHTCAVLGNKGYIFGGRVLQTRMNDLHYL---NLDTWTWSGRITI----- 240

  Fly   429 ADADDGNRGYPKPRKCFSCVQHQSSTGDIEAFITGGLQGDFSTYFSDIWKLNLRTKHWYRIETAI 493
                  |...||.|...:.    :...|.:.|:.|||..| :...||.|..|:.|..|.::....
Human   241 ------NGESPKHRSWHTL----TPIADDKLFLCGGLSAD-NIPLSDGWIHNVTTNCWKQLTHLP 294

  Fly   494 LPRPLYFHSAAHSDNGCMYVFGGI--EYIDKEMRRRNDLYKMWMTVP-KLSEMCWDAITYYNDNL 555
            ..||..:|:|.......:.||||.  :.:..:....|||. ::.|.| .|...|.|.|.      
Human   295 KTRPRLWHTACLGKENEIMVFGGSKDDLLALDTGHCNDLL-IFQTQPYSLLRSCLDCIG------ 352

  Fly   556 DLYDRKTLLEAGIPKRFTERLPPQ 579
               ....:||:.|     ..|||:
Human   353 ---KNSIMLESQI-----SLLPPK 368

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
slimNP_523782.1 KELCH repeat 203..263 CDD:276965 18/59 (31%)
KELCH repeat 267..321 CDD:276965 11/57 (19%)
KELCH repeat 324..364 CDD:276965 11/66 (17%)
Kelch_1 325..372 CDD:279660 13/73 (18%)
Kelch_4 441..492 CDD:290154 13/50 (26%)
KELCH repeat 442..495 CDD:276965 13/52 (25%)
KLHDC1NP_751943.1 KELCH repeat 13..65 CDD:276965 18/59 (31%)
Kelch_5 13..54 CDD:290565 14/45 (31%)
Kelch 1 24..76 15/59 (25%)
KELCH repeat 69..194 CDD:276965 26/140 (19%)
Kelch_3 78..124 CDD:290151 13/51 (25%)
Kelch 2 80..134 12/59 (20%)
Kelch 3 135..181 8/50 (16%)
Kelch_3 <170..205 CDD:290151 10/39 (26%)
KELCH repeat 197..235 CDD:276965 9/40 (23%)
Kelch_3 206..256 CDD:290151 13/67 (19%)
Kelch 4 208..258 12/67 (18%)
Kelch_4 247..294 CDD:290154 13/51 (25%)
KELCH repeat 248..294 CDD:276965 13/50 (26%)
Kelch 5 260..307 15/47 (32%)
Kelch 6 311..361 15/59 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0379
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.