DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment slim and klhdc2

DIOPT Version :9

Sequence 1:NP_523782.1 Gene:slim / 37121 FlyBaseID:FBgn0261477 Length:609 Species:Drosophila melanogaster
Sequence 2:NP_001096337.1 Gene:klhdc2 / 100124923 XenbaseID:XB-GENE-1006177 Length:159 Species:Xenopus tropicalis


Alignment Length:265 Identity:45/265 - (16%)
Similarity:64/265 - (24%) Gaps:140/265 - (52%)


- Green bases have known domain annotations that are detailed below.


  Fly   104 SDLDEEEEEEDDDVDVDVDYGDTDSESEFEEMYSDEWTSSSDELDEGTELSKSVLNVFLSSDKQQ 168
            :|.|.|||||:||.|                          |.:||                   
 Frog    10 ADADGEEEEEEDDDD--------------------------DLVDE------------------- 29

  Fly   169 SQMAGQIPMYAFQPLRLVKCQYRDKHIPGGFPLARSGHRIIASNSHLYSLGGYNPRSAMSASRHG 233
                                         ..|..||||..:.....::..|||  ::|.....:.
 Frog    30 -----------------------------SIPAERSGHVAVTDGQSIFVWGGY--KNAPVRGFYD 63

  Fly   234 RCLLFQELWSYNFATRTWRLELNAGNAANMPVELASNALTIHNNVLISHGGTGYPFGVSCSNDCY 298
            ..|...|:|.|:....:|:                                              
 Frog    64 FYLPRDEIWIYDMENGSWQ---------------------------------------------- 82

  Fly   299 VYRTASAGATPGVDRLQVKGDLPTAQYGPGIVIHKHFLYTIGGTTGFDYTCDVYRLDL--RTG-- 359
                          |::.||::|.:..|.........||..||......|...|.|:|  |.|  
 Frog    83 --------------RVKTKGEIPLSMSGSCAACVDKVLYLFGGHHAHGNTNMFYMLNLNPRDGDL 133

  Fly   360 IWENV 364
            .||.|
 Frog   134 FWEKV 138

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
slimNP_523782.1 KELCH repeat 203..263 CDD:276965 13/59 (22%)
KELCH repeat 267..321 CDD:276965 3/53 (6%)
KELCH repeat 324..364 CDD:276965 13/43 (30%)
Kelch_1 325..372 CDD:279660 14/44 (32%)
Kelch_4 441..492 CDD:290154
KELCH repeat 442..495 CDD:276965
klhdc2NP_001096337.1 PLN02193 <32..>122 CDD:330882 24/151 (16%)
KELCH repeat 35..91 CDD:276965 16/117 (14%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.