DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment IVD and Acox57D-d

DIOPT Version :9

Sequence 1:XP_016877638.1 Gene:IVD / 3712 HGNCID:6186 Length:516 Species:Homo sapiens
Sequence 2:NP_523803.1 Gene:Acox57D-d / 37446 FlyBaseID:FBgn0034629 Length:677 Species:Drosophila melanogaster


Alignment Length:307 Identity:61/307 - (19%)
Similarity:107/307 - (34%) Gaps:95/307 - (30%)


- Green bases have known domain annotations that are detailed below.


Human   161 HSNLCINQLVRNGNEAQKEKYLPKLISGEYIGALAMSEPNAGSDVVSMKLKA--EKKGNHYILN- 222
            |..:.::.:...|...|.||:.....:...||..|.:|...|::|..:..:|  :.|.:.::|| 
  Fly   123 HITMFVDVIKGQGTAEQVEKWGKAAENCNIIGTYAQTELAHGTNVRGLATRADFDPKTDEFVLNT 187

Human   223 ----GNKFWITN-GPDADVLIVYAKTDLAAVPASRGITAFIV-------EKGMPGFSTSKKLDKL 275
                ..|:|... |..|:..:|.|:..:|.|  ..|:..|||       ...:||....:...||
  Fly   188 PNLEAYKWWPGGLGHTANHAMVVAQLYIADV--HHGVQMFIVPLRDSETHMPLPGVDIGEIGKKL 250

Human   276 GMRGSNTCELIFEDCKIPAANILGH----ENKGVY------------------VLMSGLDLERLV 318
            ||...|...|.....:||..|:|..    |..|.:                  :::|  ....|:
  Fly   251 GMASVNQGFLGLNHVRIPRTNMLMKFAKVERDGTFKASPASRINYLTMVYTRCLIVS--QNSTLL 313

Human   319 LAGGPLGLMQA----------------VLDHTIPYL-----------------HVREAFGQKI-- 348
            ||...:....:                ::||....|                 ::.|.:.|.:  
  Fly   314 LAAATIATRYSAVRRQSPIEPNQPEPQIIDHVTQRLKLFPEIATGIAYHLATEYMWEMYAQTVQE 378

Human   349 ---GHFQLMQGKMADMYTRLMACRQYVYNVAKACDEGHCTAKDCAGV 392
               |.|:    ::.||:  :::|...|.          ||...|||:
  Fly   379 ANNGKFE----RLPDMH--ILSCALKVL----------CTTDGCAGI 409

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
IVDXP_016877638.1 None
Acox57D-dNP_523803.1 ACAD 14..653 CDD:299127 61/307 (20%)
PLN02443 16..677 CDD:178062 61/307 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1960
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.