DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment IVD and Acox57D-p

DIOPT Version :9

Sequence 1:XP_016877638.1 Gene:IVD / 3712 HGNCID:6186 Length:516 Species:Homo sapiens
Sequence 2:NP_001286677.1 Gene:Acox57D-p / 37445 FlyBaseID:FBgn0034628 Length:677 Species:Drosophila melanogaster


Alignment Length:464 Identity:93/464 - (20%)
Similarity:149/464 - (32%) Gaps:142/464 - (30%)


- Green bases have known domain annotations that are detailed below.


Human   101 AAWKSSHSFLEFWKQLGNLGVLGITAPVQYGGSGLGYLEHVLVMEEISRASGAVGLSYGAHSNLC 165
            ||..:|..|..:|  .|...||.....|:      .|:|..:.:.|:      :.|....|..: 
  Fly    22 AASFNSEEFAAWW--AGGEEVLKFNRGVR------EYMEKDVDLSEM------LQLQNKTHEEI- 71

Human   166 INQLVRNGNEAQKEKYLPKLISGEYIGALAMSEPNAGSDVVSMKLKAEKKGNHYILNGNKFWITN 230
            |....|...|..|:  |.:|          ..|.|.|.||                    :| .|
  Fly    72 IEFSTRGAIEGAKK--LRRL----------QEERNPGGDV--------------------YW-PN 103

Human   231 GPDADVLIVYAKTDLAAVPASR--GITAFIVEKGMPGFSTSKKLDKLGMRGSNTCELIFEDCKIP 293
            ..||.|:       ...||...  |:...::.|.:....|.::.::.|.|..     :||.|...
  Fly   104 LYDAQVM-------WGLVPGGNPFGVMYVMLVKALQAQCTPEQYEEFGKRVE-----LFEICGTY 156

Human   294 AANILGHENKGVYV--LMSGLDLER-----------------------------LVLA------- 320
            |...|||   |.|:  |.:..|.:|                             ||:|       
  Fly   157 AQTELGH---GTYLRGLETRADFDRKTDQFVLNTPNISSYKWWPGGLGHSSNHCLVMAQLYIDGD 218

Human   321 -GGPLGLMQAVLD----HTIPYLHVREAFGQKIGHFQLMQGKMADMYTRLMACRQYVYNVAKACD 380
             .||......|.|    ..:|.:|:.: .|:|:|...:..|.:.....|:...|..:.:.....|
  Fly   219 CKGPHMFFIQVRDEDTHEPLPGVHIGD-IGKKMGFIGVNNGFLGLKNVRIPRTRMLMRHAQVKAD 282

Human   381 EGHCTAKDCAGVILYSAECATQ--------VALDGIQCFGQTFSA--QHPPGREGETRGQTSLEQ 435
            ..:.::.  ..|:.|.|...|:        |.|.........:||  :..|....|...|. ::.
  Fly   283 GSYVSSP--TNVLTYFAMVRTRCVIAKNNAVMLASAATIATRYSAVRRQSPINPNEREPQI-MDH 344

Human   436 VSTARELRCKILLPELTPRVLLPQLASW--------ISD------QKLPFLKILLCS-PTSLGQS 485
            |:...:     |.||:...|...:...:        |.|      ::||.|..|.|: ..:....
  Fly   345 VTQQMK-----LFPEIATSVAYRKAGDYLWNLYDVTIEDIENGKYERLPELHSLSCALKVTCSMD 404

Human   486 SLAGFTKLR 494
            |.:|..|||
  Fly   405 SASGVEKLR 413

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
IVDXP_016877638.1 None
Acox57D-pNP_001286677.1 ACAD 14..653 CDD:299127 93/464 (20%)
PLN02443 16..677 CDD:178062 93/464 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1960
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.