DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment IVD and CG5009

DIOPT Version :9

Sequence 1:XP_016877638.1 Gene:IVD / 3712 HGNCID:6186 Length:516 Species:Homo sapiens
Sequence 2:NP_611264.2 Gene:CG5009 / 37028 FlyBaseID:FBgn0027572 Length:669 Species:Drosophila melanogaster


Alignment Length:461 Identity:97/461 - (21%)
Similarity:165/461 - (35%) Gaps:128/461 - (27%)


- Green bases have known domain annotations that are detailed below.


Human   111 EFWKQLGNLGVLGITAPVQYGGSGLGYLEH-----------VLVMEEIS--RASGAVGL-SYGA- 160
            |.:|:...|..|.:..|.......:.||.|           .::.|:|.  ||.|..|: :|.| 
  Fly    33 ERFKEKKALEKLFLEDPALQDDLPISYLSHKELYEHSLRKACIIGEKIRKLRADGEDGVDTYNAL 97

Human   161 ------------------HSNLCINQLVRNGNEAQKEKYLPKLISGEYIGALAMSEPNAGSDVVS 207
                              |..:.:..::..|...|:.::|.|....|.||..|.:|...|:.:..
  Fly    98 LGGSLGSAILKEGNPLALHYVMFVPTIMGQGTMDQQVEWLSKAWDCEIIGTYAQTELGHGTFLRG 162

Human   208 MKLKAEKKGN--HYILN-----GNKFWITN-GPDADVLIVYAKTDLAAVPASRGITAFIVE---- 260
            ::.:|:...:  .:::|     ..|:|... |..|:..:|.|:  |......||:..|||:    
  Fly   163 LETRADYDASTQEFVINTPSLSAYKWWPGGLGHTANHAVVVAQ--LYTKGEFRGLAPFIVQLRDS 225

Human   261 ---KGMPGFSTSKKLDKLGMRGSNTCELIFEDCKIPAANILGHENKGVYVLMSGLDL--ERLVLA 320
               :.|||........||||:|.|...|..::.::|..|:|   .|...||..|..:  :..||.
  Fly   226 DTHRPMPGIDIGDIGTKLGMKGVNNGYLGLKNVRVPLNNML---MKNQQVLPDGTYVAPKNSVLT 287

Human   321 GGPLGLMQAVLDHTIPYLHVREAFGQKIGHFQLMQGKMADMYTRLMACRQY-------------- 371
            .|.:..::..|        :|:. .|.:       .|.:.:.||..|.|:.              
  Fly   288 YGTMMFVRCAL--------IRDT-AQSL-------AKASTIATRYSAVRRQSPIDPNQPEPQIMD 336

Human   372 ---------------------------VYNVAKA-CDEGHCT------AKDCAGVILYSAECATQ 402
                                       :|||... .::|:..      |..|....:.||:.|..
  Fly   337 HTTQQLKLFPQIAKAIVFKTTGDGIWNMYNVISGEIEQGNLDRLPEMHALSCCLKAICSADAAAG 401

Human   403 VALDGIQCFGQTF-SAQHPPGREGET------RGQTSLEQVSTARELRCKILLPELTPRVLLPQL 460
            |....:.|.|..: ...:.|...|.|      .|:.::..:.|||.| .|:....|....|:|.:
  Fly   402 VETCRLSCGGHGYMDCSNFPTIYGMTTAVCTYEGENTVMLLQTARYL-VKVYGQALNGEKLVPTV 465

Human   461 ASWISD 466
             |:|||
  Fly   466 -SYISD 470

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
IVDXP_016877638.1 None
CG5009NP_611264.2 AXO 8..645 CDD:173839 97/461 (21%)
PLN02443 10..669 CDD:178062 97/461 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1960
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.