DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment IVD and CG17544

DIOPT Version :9

Sequence 1:XP_016877638.1 Gene:IVD / 3712 HGNCID:6186 Length:516 Species:Homo sapiens
Sequence 2:NP_001163015.1 Gene:CG17544 / 35213 FlyBaseID:FBgn0032775 Length:693 Species:Drosophila melanogaster


Alignment Length:555 Identity:120/555 - (21%)
Similarity:204/555 - (36%) Gaps:150/555 - (27%)


- Green bases have known domain annotations that are detailed below.


Human    66 PKAQEIDRSN-EFKNLRVSWEVRAVGGSQGVGLSCTAAWKSSHSFLEFWKQLGNLGVL---GITA 126
            |.|....|:| ::|.||:.:|     ..||:.:.           .:.|::|.|..:.   ..|.
  Fly    17 PLAVYRKRANFDWKRLRLIFE-----KEQGLRIK-----------YKVWRRLENDPLFAHPSRTL 65

Human   127 PV----QYGGSGLGYLEHV-LVMEEISRASGAVGLSYGAHSNLCI------------------NQ 168
            |:    :.....:..::|: ||.:||...|.:....|..:.|..:                  |.
  Fly    66 PMDEQKRLCAMQVNRMKHLDLVPKEIESLSFSAKTKYLMYINEALACYSPSLSVKIALGVGLFNN 130

Human   169 LVRNGNEAQKEKYLPKLISGEYIGALAMSEPNAGSDVVSMKLKA--EKKGNHYILN-----GNKF 226
            .:|.....:.:||:....:.|.|..||::|.:.||:..|::..|  :.....:::|     ..|.
  Fly   131 AIRAMGTEKHQKYIEAAWNREVITCLAITELSHGSNTKSIRTTATYDPTTQEFVINTPDFEAAKC 195

Human   227 WITN-GPDADVLIVYAKTDLAAVPASRGITAFIVE-------KGMPGFSTSKKLDKLGMRGSNTC 283
            |:.| |..|.|.:.:|.. ..|...:.|:..|::.       ...||.......:|.|:.|.:..
  Fly   196 WVGNLGKTATVAMTFANL-YTADGQNHGLHGFLIPIRDPKTLLSYPGVLVGDIGEKCGLNGIDNG 259

Human   284 ELIFEDCKIPAANILGHEN----KGVY---------VLMSGLDLERLVLAGGPLGLMQ------- 328
            .::|.:.:||..|:|...:    :|||         ||.:.|:    ..:.|.:|:||       
  Fly   260 FVVFTNYRIPRDNLLNRTSDVTPEGVYESVFTEPGKVLGAALE----SFSAGRIGIMQESANTLC 320

Human   329 --AVLDHTIPYLHVREAFG-QKIGHFQLMQGKMADMYTRLMACRQYVYNVAKACDEGHCT----- 385
              ||:  .:.|..||:.|| ::.|.      :||.:..:|...|.:.| :|.||.:...|     
  Fly   321 SAAVI--AVRYSAVRKQFGPERHGE------EMAILEYQLHQYRIFPY-LAAACVQKIATEELTS 376

Human   386 ----------------------AKDCAGVILYSAECATQVALDGIQCFGQTFSAQHPPGREGETR 428
                                  |.:...:|..|....|..|.|.||      .|:...|..|..:
  Fly   377 TYMEIIARSQADSNGFDVLTQNAAEIHALISSSKPLITWAARDAIQ------EAREACGGHGYLQ 435

Human   429 GQTSLEQVSTARELRCKILLPELTPRVLLPQLASWISDQ------KLPFLKILLCSPTS----LG 483
            . ..|.|:.|..:..|..   |....||..|.::|:..|      :.|...:......|    |.
  Fly   436 A-AKLGQMRTDHDPLCTY---EGDNNVLGQQASNWLLRQWSAKELETPIGSVKFLERRSELLALN 496

Human   484 QSSLAGFTKL-RWPYPL-----LQPHLLPHPYTTA 512
            .:|||..|.: .|.:.|     |..||:..  |||
  Fly   497 YASLAQKTPIASWQFSLRCYEWLLCHLMAK--TTA 529

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
IVDXP_016877638.1 None
CG17544NP_001163015.1 AXO 16..670 CDD:173839 120/555 (22%)
PLN02443 18..687 CDD:178062 119/554 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1960
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.