DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment IVD and CG9527

DIOPT Version :9

Sequence 1:XP_016877638.1 Gene:IVD / 3712 HGNCID:6186 Length:516 Species:Homo sapiens
Sequence 2:NP_001137800.1 Gene:CG9527 / 33898 FlyBaseID:FBgn0031813 Length:724 Species:Drosophila melanogaster


Alignment Length:552 Identity:119/552 - (21%)
Similarity:212/552 - (38%) Gaps:148/552 - (26%)


- Green bases have known domain annotations that are detailed below.


Human    25 AGFVSQRAHSLLPVDDAINGLSEEQRQLRQTMAKFLQEHLAPKAQ-----EIDRSNEFKNLR--V 82
            |.|..:|.:.:|..:|.|        :|:..:.:::::|  |..|     :::|:.|..|.|  :
  Fly    61 ASFCYKRMNVVLEGEDHI--------RLKHKVWQWMEQH--PDYQREPGSDLERTREMANKRQHL 115

Human    83 SWEVRAVGGSQGVGLSCTAAWKSSHSFLEFWKQLGNLGVLGITAPVQYGGSGLGYLEHVLVMEEI 147
            .||.:..|.::.:|        :.|..|.|.:.:.:   ...:..|::|.| .|.....||    
  Fly   116 LWEQQFYGVNEYLG--------TPHLLLAFGQAIFS---YDFSTSVKFGLS-TGMFPSTLV---- 164

Human   148 SRASGAVGLSYGAHSNLCINQLVRNGNEAQKEKYLPKLISGEYIGALAMSEPNAGSDVVSMKLKA 212
            |..||.:|                        ||:.|:.....:||.|::|.:.|::.:.|:.:|
  Fly   165 SNGSGRLG------------------------KYVAKIADNRILGAYALTEISHGTNALGMRTRA 205

Human   213 --EKKGNHYILN-----GNKFWITN-GPDADVLIVYAKTDLAAVPASR--GITAFIV----EKGM 263
              :.|...:|::     ..|.|:.| |......||||:   ..||..:  |:.||:|    |:.:
  Fly   206 TYDVKRQEFIIHTPDFEAAKCWVGNLGKTCTHAIVYAQ---LYVPDDKHQGLQAFLVPIRDERTL 267

Human   264 ---PGFSTSKKLDKLGMRGSNTCELIFEDCKIPAANILG----------------HENKGVYVLM 309
               ||.:.....:|:|:.|.:...::|...:||.||:|.                .|.|.:...:
  Fly   268 LPFPGVTVGDMGEKIGLNGIDNGFVMFNQYRIPKANLLSKTGDIDAQGNYTSKIKDERKRLGASL 332

Human   310 SGLDLERL-VLAGGPLGLMQAVLDHTIPYLHVREAFGQ-------KIGHFQLMQGKMADMYTRLM 366
            ..|.:.|: :.|...:.|.:||...| .|...|..||.       .:..:|..|.::.......:
  Fly   333 GALSVGRVNITAITYVALSKAVTIAT-RYAASRRQFGPTNSPAEWPVIEYQSQQYRLIPHLATTI 396

Human   367 ACRQYVYNVAKACDE-------GHCTAKDCAGVILYSAE-----CATQVALDGIQCFGQTFSAQH 419
            |.|.....:.|...:       |..|::  ||:.:::..     .||..|.||||      ..:.
  Fly   397 ALRVATLWIGKENVDLTMKGFTGEDTSQ--AGMEIHAISSALKPVATWAARDGIQ------ECRE 453

Human   420 PPGREGETRGQTSLEQVSTARELRCKILLPELTPRVLLPQLASW-ISDQK-------------LP 470
            ..|..|..: .:.|.::....:..|..   |.....|:.|.::| ||.|:             :.
  Fly   454 ACGGHGYLK-SSGLGELRNDNDANCTY---EGENNTLIQQASNWLISLQRNNADFVAVSPLETVS 514

Human   471 FLKILLCSPTSLGQSSLAGFTKLRWPYPLLQP 502
            |||.:.....|.||.        |.|..:|.|
  Fly   515 FLKDMDTILQSKGQE--------RTPAEVLDP 538

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
IVDXP_016877638.1 None
CG9527NP_001137800.1 ACAD 52..694 CDD:299127 119/552 (22%)
PLN02312 56..682 CDD:215178 119/552 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1960
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.