DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment PIG-O and NPP2

DIOPT Version :9

Sequence 1:NP_611332.1 Gene:PIG-O / 37118 FlyBaseID:FBgn0034346 Length:1077 Species:Drosophila melanogaster
Sequence 2:NP_010900.1 Gene:NPP2 / 856699 SGDID:S000000742 Length:493 Species:Saccharomyces cerevisiae


Alignment Length:275 Identity:52/275 - (18%)
Similarity:95/275 - (34%) Gaps:90/275 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly    76 KSKVIVLVVDAL-------KYEFGLYRANATDPLPYENKLVVLQELLQQNPDHARLMRFRADPPT 133
            |:..|::.:|..       ||...||..:.... ||:..:.....::   |..          ||
Yeast    75 KTLTILISIDGFHPRLIDAKYTPFLYNLHNLRS-PYDMNITTAPYMI---PSF----------PT 125

  Fly   134 TTLQRLKGLTTGSLPTFIDIG-------SNFASPEINEDNIIDQIVKNDLPVVFLGDSTW----- 186
            .|......:.||..|  |:.|       .||.|.|...:|:..:|..|      ..|..|     
Yeast   126 QTFPNHWSMVTGKYP--IEHGIVSNIFWDNFTSSEFRPNNLDARIWSN------TADPIWQLLQT 182

  Fly   187 ---------TDLYP--------H----RFKRSYSYPSFDIFD---------LDSVDNEILKHLPK 221
                     |.::|        |    |.:..:.:..|:.::         ...:|...||..| 
Yeast   183 ESQGEYKVATHMWPGSEVVYEDHGDVPRERMPFYFGKFNQWEKLQDKLAQIFRYIDMPQLKDRP- 246

  Fly   222 ELESKDWQVLVAHFLGVDHCGHKHG-PMHEEMARKL-GEMNEVIRSVVAAMDNDTTL-----LVM 279
                   ::::::...||..||..| .:.::..:|| ||::.....::..:.....|     :::
Yeast   247 -------ELVISYIPNVDSYGHSFGYDLRDKRLQKLIGEVDGFFLDLIEGLQKRNLLKISNVMIV 304

  Fly   280 GDHGMT----ASGDH 290
            .||||:    ..|:|
Yeast   305 SDHGMSNVNANDGEH 319

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PIG-ONP_611332.1 GPI_EPT_3 74..349 CDD:293747 52/275 (19%)
NPP2NP_010900.1 Npp1 43..479 CDD:224441 52/275 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1524
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.