DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment PIG-O and Enpp1

DIOPT Version :9

Sequence 1:NP_611332.1 Gene:PIG-O / 37118 FlyBaseID:FBgn0034346 Length:1077 Species:Drosophila melanogaster
Sequence 2:NP_445987.1 Gene:Enpp1 / 85496 RGDID:628825 Length:906 Species:Rattus norvegicus


Alignment Length:177 Identity:44/177 - (24%)
Similarity:76/177 - (42%) Gaps:27/177 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly   132 PTTTLQRLKGLTTGSLPTFIDIGSN-FASPEINEDNIIDQIVKNDLPVVFLGDSTWTDLYPHRFK 195
            ||.|......:.||..|....|..| ...|::|....:....|.: |:.:.|...|... .|:..
  Rat   235 PTKTFPNHYSIVTGLYPESHGIIDNKMYDPKMNASFSLKSKEKFN-PLWYKGQPIWVTA-NHQEV 297

  Fly   196 RS--YSYPSFDIFDLDSVDNEILK----HLPKE---LESKDWQVLVA----HFLGV-----DHCG 242
            ||  |.:|..|: ::|.:..:|.|    .:|.|   |...:|..|.:    ||..:     |..|
  Rat   298 RSGTYFWPGSDV-EIDGILPDIYKVYNGSVPFEERILAVLEWLQLPSYERPHFYTLYLEEPDSSG 361

  Fly   243 HKHGPMHEEMARKLGEMNEVIRSVV-----AAMDNDTTLLVMGDHGM 284
            |.|||:..|:.:.|.:::.::..::     ..:|....|:::.||||
  Rat   362 HSHGPVSSEVIKALQKVDHIVGMLMDGLKDLGLDKCLNLILISDHGM 408

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PIG-ONP_611332.1 GPI_EPT_3 74..349 CDD:293747 44/177 (25%)
Enpp1NP_445987.1 cytoplasmic tail 1..58
transmembrane domain 59..79
SO 86..126 CDD:197571
cysteine-rich domain 87..168
SO 127..170 CDD:197571
catalytic domain 191..573 44/177 (25%)
Phosphodiest 194..520 CDD:366747 44/177 (25%)
Linker. /evidence=ECO:0000250|UniProtKB:P06802 579..628
nuclease-like domain 639..906
NUC 657..888 CDD:214683
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1524
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.