DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment PIG-O and enpp6

DIOPT Version :9

Sequence 1:NP_611332.1 Gene:PIG-O / 37118 FlyBaseID:FBgn0034346 Length:1077 Species:Drosophila melanogaster
Sequence 2:NP_001013545.1 Gene:enpp6 / 791915 ZFINID:ZDB-GENE-031205-1 Length:438 Species:Danio rerio


Alignment Length:248 Identity:46/248 - (18%)
Similarity:95/248 - (38%) Gaps:54/248 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    71 LCLPQKS--KVIVLVVDALKYEFGLYRANATDPLPYENKLVVLQELLQQNPDHARLMRFRADPPT 133
            ||..:.:  |::|.::|..::::       .|.|   :.|...:|:::..   .::.....|.|:
Zfish    16 LCRQRDANRKLLVFLIDGFRHDY-------MDDL---HNLPGFREIVENG---VKVDYLTPDFPS 67

  Fly   134 TTLQRLKGLTTGSLPTFIDIGSNFA-SPEINEDNIIDQIVKNDLPVVFLG-DSTWTDLYPHRFKR 196
            .:......|.||.......:..|:. ..:..::.:|.....:.||:.:.| :..|..: ....|:
Zfish    68 LSYPNYYSLMTGRHCEVHQMTGNYMWDTDTQKEFLIGTNPDSRLPMWWDGSEPLWVTM-QKLGKK 131

  Fly   197 SYSY--PSFDIFDL--------------------DSVDNEILKHLPKELESKDWQVLVAHFLGVD 239
            .|.|  |..::..|                    ||::|.:     ..|:|....:...::..:|
Zfish   132 VYMYYWPGCEVTILGVRPTFCEEYVYNPSEKNLTDSMENAL-----NALKSSKADMAGIYYEKID 191

  Fly   240 HCGHKHGPMHEEMARKLGE-------MNEVIRSVVAAMDNDTTLLVMGDHGMT 285
            ..||..||...|:.|.:..       :|:.||.  ..|.:...:::..|||||
Zfish   192 VEGHHFGPRSPEIQRAIRSLDQAFQILNQKIRE--KNMRDTINVVLFSDHGMT 242

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PIG-ONP_611332.1 GPI_EPT_3 74..349 CDD:293747 44/245 (18%)
enpp6NP_001013545.1 Enpp 24..395 CDD:293742 44/240 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1524
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.