DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment PIG-O and zgc:153896

DIOPT Version :9

Sequence 1:NP_611332.1 Gene:PIG-O / 37118 FlyBaseID:FBgn0034346 Length:1077 Species:Drosophila melanogaster
Sequence 2:NP_001038659.2 Gene:zgc:153896 / 569930 ZFINID:ZDB-GENE-060825-119 Length:439 Species:Danio rerio


Alignment Length:332 Identity:61/332 - (18%)
Similarity:107/332 - (32%) Gaps:119/332 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly   131 PPTTTLQRLKGLTTGSLPTFIDI---------------GSNFASPEINEDNIIDQIVKNDLPVVF 180
            |...||::.:....|.||.:|..               |.|::...:|...:.:....:|     
Zfish   104 PHKATLKKSEWWDNGVLPLWITAQKQGLKTASFYYPGGGVNYSGQAVNRFLVENHGSPDD----- 163

  Fly   181 LGDSTWTDLYPHRFKRSYSYPSFDIFDLDSVDNEILKHLPKELESKDWQVLVAHFLGVDHCGHKH 245
             .::.|..                  ::|:|.....|        :|:..:..::...|:.||..
Zfish   164 -NETEWQQ------------------NIDTVMGWFAK--------EDFDFVTLYYGEPDNVGHAV 201

  Fly   246 GP-------MHEEMARKLGEMNEVIRSVVAAMDNDTTLLVMGDHGMTASGDHGGDTDDETNALLF 303
            ||       :.|::.|.:|.:.|.|..  .|:.:...:::..|||||.. .:..:..:...|...
Zfish   202 GPETHERRKIIEQIDRTIGYLRESIHK--NALTDHLNVILTSDHGMTTI-KNATEVKEIVLANYI 263

  Fly   304 AYSKQHRFYGNDSGSDSEMLQQIDLVPTLATILGVPIPYSNLGLVNFNIVPDLRVPHLNKFQTLL 368
            :..|..||               ||           :.|...|::         .|...|     
Zfish   264 SLLKLTRF---------------DL-----------LDYGGFGMI---------TPREGK----- 288

  Fly   369 LHSWQNAQQIYRYFFQYALENKR-TFNVEQMDHLETEFILLTH-RVQTVYNEVAFKSFVRDL--N 429
                  .|::|.     ||:|.. ...|.:.|.|...|.:..| |:|.:.       .:.||  |
Zfish   289 ------EQEVYN-----ALKNAHPNLTVYRKDELPENFHMKKHARIQPIV-------LLADLGFN 335

  Fly   430 TNLRDIL 436
            .|.|.||
Zfish   336 INSRLIL 342

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PIG-ONP_611332.1 GPI_EPT_3 74..349 CDD:293747 40/239 (17%)
zgc:153896NP_001038659.2 Enpp 27..392 CDD:293742 61/332 (18%)
Phosphodiest 29..352 CDD:279931 61/332 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1524
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.