Sequence 1: | NP_611332.1 | Gene: | PIG-O / 37118 | FlyBaseID: | FBgn0034346 | Length: | 1077 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001243734.1 | Gene: | enpp7.1 / 557756 | ZFINID: | ZDB-GENE-040724-13 | Length: | 485 | Species: | Danio rerio |
Alignment Length: | 273 | Identity: | 47/273 - (17%) |
---|---|---|---|
Similarity: | 91/273 - (33%) | Gaps: | 96/273 - (35%) |
- Green bases have known domain annotations that are detailed below.
Fly 72 CLPQKSKVIVLVVDALKYEF---------------GLYRANATDPL------------------- 102
Fly 103 ------------PYENKLVVLQELLQQNPDHARLMRFRADPPTTTLQRLKGLTTGSLPTFIDIGS 155
Fly 156 NFASPEINEDNIIDQIVKNDLPVVFLGDSTWTDLYPHRFKRSYSYPSFDIFDLDSVDNEILKHLP 220
Fly 221 KELESKDWQVLVAHFLGVDHCGHKHGPMHEE-------MARKLGEMNEVIRSVVAAMDNDTTLLV 278
Fly 279 MGDHGMTA--SGD 289 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
PIG-O | NP_611332.1 | GPI_EPT_3 | 74..349 | CDD:293747 | 46/271 (17%) |
enpp7.1 | NP_001243734.1 | Enpp | 29..396 | CDD:293742 | 45/268 (17%) |
Phosphodiest | 31..356 | CDD:279931 | 44/266 (17%) |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_COG1524 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
ZFIN | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.900 |