DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment PIG-O and enpp7.1

DIOPT Version :9

Sequence 1:NP_611332.1 Gene:PIG-O / 37118 FlyBaseID:FBgn0034346 Length:1077 Species:Drosophila melanogaster
Sequence 2:NP_001243734.1 Gene:enpp7.1 / 557756 ZFINID:ZDB-GENE-040724-13 Length:485 Species:Danio rerio


Alignment Length:273 Identity:47/273 - (17%)
Similarity:91/273 - (33%) Gaps:96/273 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly    72 CLPQKSKVIVLVVDALKYEF---------------GLYRANATDPL------------------- 102
            |...|:|::::..|..::::               |:..|..|.|.                   
Zfish    24 CTTGKNKLLLISFDGFRWDYDRDVDTPNLDKMAVDGVKAAYVTPPFLTITSPTHFTLLSGRYIEN 88

  Fly   103 ------------PYENKLVVLQELLQQNPDHARLMRFRADPPTTTLQRLKGLTTGSLPTFIDIGS 155
                        ..|.|...:.:.:....|:..|      |...|.|| :||.|||| .|....:
Zfish    89 HGVIHNNWFNTTTQEKKQYYMTQFVNDYWDNGSL------PIWITAQR-QGLKTGSL-HFPGTAA 145

  Fly   156 NFASPEINEDNIIDQIVKNDLPVVFLGDSTWTDLYPHRFKRSYSYPSFDIFDLDSVDNEILKHLP 220
            .:.:.:|....:..:...:      ..::.|                     ::.|| :::|...
Zfish   146 KYQNEKIKVGEVEPRFYDH------TNETLW---------------------MEKVD-KVMKDWF 182

  Fly   221 KELESKDWQVLVAHFLGVDHCGHKHGPMHEE-------MARKLGEMNEVIRSVVAAMDNDTTLLV 278
            |:   :|...:..:|...|..|||:||...|       :.|.:|.:.|..:.  ..:.:...:::
Zfish   183 KD---QDLDFVTLYFGDPDSTGHKYGPDSPERREAVKKVDRTVGYIRETAKK--HGLSDHLNIII 242

  Fly   279 MGDHGMTA--SGD 289
            ..||||:.  .||
Zfish   243 TADHGMSTVFKGD 255

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PIG-ONP_611332.1 GPI_EPT_3 74..349 CDD:293747 46/271 (17%)
enpp7.1NP_001243734.1 Enpp 29..396 CDD:293742 45/268 (17%)
Phosphodiest 31..356 CDD:279931 44/266 (17%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1524
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.