DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment PIG-O and ENPP7

DIOPT Version :9

Sequence 1:NP_611332.1 Gene:PIG-O / 37118 FlyBaseID:FBgn0034346 Length:1077 Species:Drosophila melanogaster
Sequence 2:XP_011523039.1 Gene:ENPP7 / 339221 HGNCID:23764 Length:464 Species:Homo sapiens


Alignment Length:201 Identity:41/201 - (20%)
Similarity:66/201 - (32%) Gaps:76/201 - (37%)


- Green bases have known domain annotations that are detailed below.


  Fly   226 KDWQVLVAHFLGVDHCGHKHG---PMHEEMARKLGEMNEVIRSVVAA--MDNDTTLLVMGDHGMT 285
            :|..::..:|...|..||::|   |...||.|::......:|..:|.  :.:...|::..|||||
Human   259 EDLDLVTLYFGEPDSTGHRYGPESPERREMVRQVDRTVGYLRESIARNHLTDRLNLIITSDHGMT 323

  Fly   286 ASGDHGGD-------------------TDDETNALLF---------------AYSKQHRF----- 311
            ......||                   .|...|.:|.               |:.|.|.:     
Human   324 TVDKRAGDLVEFHKFPNFTFRDIEFELLDYGPNGMLLPKEGRLEKVYDALKDAHPKLHVYKKEAF 388

  Fly   312 -----YGNDSGSDSEMLQQIDLVPTLATILGVPIPYSNLGLVNFNIV---------PDLRVPHLN 362
                 |.|:              |.:..:|    .||:||.|...::         ||.|...|.
Human   389 PEAFHYANN--------------PRVTPLL----MYSDLGYVIHGVLWLSLESALPPDGRPTLLP 435

  Fly   363 KFQTLL 368
            |.::.|
Human   436 KGRSAL 441

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PIG-ONP_611332.1 GPI_EPT_3 74..349 CDD:293747 34/171 (20%)
ENPP7XP_011523039.1 Enpp 104..325 CDD:293742 18/65 (28%)
Phosphodiest 106..413 CDD:279931 34/171 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1524
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.