DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment PIG-O and Enpp4

DIOPT Version :9

Sequence 1:NP_611332.1 Gene:PIG-O / 37118 FlyBaseID:FBgn0034346 Length:1077 Species:Drosophila melanogaster
Sequence 2:XP_006524196.1 Gene:Enpp4 / 224794 MGIID:2682634 Length:470 Species:Mus musculus


Alignment Length:280 Identity:65/280 - (23%)
Similarity:101/280 - (36%) Gaps:75/280 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly   186 W--TDLYPHRFKRSY--SYPSFDIFDLDSVDNEILKHLPKELESKDWQVLVA--HFLGVDHCGHK 244
            |  ||:..|....||  :|.|...|      .|.|.::...|.|.:..|..|  ::...|..|||
Mouse   153 WPGTDVPIHNITASYFMNYSSSVSF------KERLGNVTTWLSSSNPPVTFAALYWEEPDVSGHK 211

  Fly   245 HGPMHEE-MARKLGEMNEVIRSVVAAMD-----NDTTLLVMGDHGMTASGDHGGDTDDETNALLF 303
            :||..:| |.|.|.|::::|..:|..:.     :...:::..||||                   
Mouse   212 YGPEDKENMRRVLKEVDDLIGDIVLKLKVLGLWDSLNVIITSDHGM------------------- 257

  Fly   304 AYSKQHRFYGNDSGSDSEMLQQIDLVPTLATI--LGVPIPYSNLGLVNFNIVPDLRVPHLNKFQT 366
            |...::|....||..|......|||.|..|.:  :.|...|..|...|         ||:|.:  
Mouse   258 AQCSKNRLIDLDSCIDRSNYSVIDLTPVAAILPKINVTEVYDKLKRCN---------PHMNVY-- 311

  Fly   367 LLLHSWQNAQQIYRYFFQYALE----------------NKRTFNVEQMDHLETEFILLTHRVQTV 415
             |..:..|     |:::|::..                ||.:|.:.  ||.....:...|.....
Mouse   312 -LKEAIPN-----RFYYQHSSRIQPIILVAEEGWTITLNKSSFKLG--DHGYDNSLPSMHPFLAA 368

  Fly   416 YNEVAFKSFVRDLNTNLRDI 435
            :.. ||:...|....|..||
Mouse   369 HGP-AFRKGYRQSTINTVDI 387

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PIG-ONP_611332.1 GPI_EPT_3 74..349 CDD:293747 45/176 (26%)
Enpp4XP_006524196.1 Enpp 43..396 CDD:293742 65/280 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1524
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.