DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment PIG-O and Enpp3

DIOPT Version :9

Sequence 1:NP_611332.1 Gene:PIG-O / 37118 FlyBaseID:FBgn0034346 Length:1077 Species:Drosophila melanogaster
Sequence 2:NP_598766.2 Gene:Enpp3 / 209558 MGIID:2143702 Length:874 Species:Mus musculus


Alignment Length:233 Identity:54/233 - (23%)
Similarity:90/233 - (38%) Gaps:45/233 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    79 VIVLVVDALKYEFGLYRANATDPLPYENKLVVLQELLQQNPDHARLMRFRADPPTTTLQRLKGLT 143
            ||:..:|..:.|   |....:..||..||       |:....|::.|  ||..||.|......:.
Mouse   161 VILFSMDGFRAE---YLQTWSTLLPNINK-------LKTCGIHSKYM--RAMYPTKTFPNHYTIV 213

  Fly   144 TGSLPT---FIDIGSNFASPEINEDNIIDQIVKNDLPVVFLGDSTW-TDLYPHRFKRSYSYPSFD 204
            ||..|.   .||  :|.....:|::..:..:.|:: |..:.|...| |.:|.......|.:|..|
Mouse   214 TGLYPESHGIID--NNMYDVHLNKNFSLSSVEKSN-PAWWSGQPIWLTAMYQGLKAACYYWPGSD 275

  Fly   205 I-----FDL------DSVDNE-----ILK--HLPKELESKDWQVLVAHFLGVDHCGHKHGPMHEE 251
            :     |..      :||..|     :|:  .|||......:.:.|..   .|..||..||:...
Mouse   276 VAVNGSFPTIYRNYSNSVPYERRITTLLQWLDLPKADRPSFYTIYVEE---PDSAGHSSGPVSAG 337

  Fly   252 MARKLGEMNEVIRSVVAA-----MDNDTTLLVMGDHGM 284
            :.:.|..::.....::..     :.|...::|:.||||
Mouse   338 VIKALQSVDNAFGMLMEGLKQRNLHNCVNIIVLADHGM 375

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PIG-ONP_611332.1 GPI_EPT_3 74..349 CDD:293747 54/233 (23%)
Enpp3NP_598766.2 SO 50..93 CDD:197571
Cell attachment site. /evidence=ECO:0000255 78..80
SO 94..137 CDD:197571
Phosphodiesterase 140..509 54/233 (23%)
Enpp 159..525 CDD:293742 54/233 (23%)
Phosphodiest 161..485 CDD:279931 54/233 (23%)
Nuclease 605..874
NUC 627..856 CDD:214683
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1524
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.