DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment PIG-O and T03G6.3

DIOPT Version :9

Sequence 1:NP_611332.1 Gene:PIG-O / 37118 FlyBaseID:FBgn0034346 Length:1077 Species:Drosophila melanogaster
Sequence 2:NP_508470.1 Gene:T03G6.3 / 180561 WormBaseID:WBGene00020195 Length:465 Species:Caenorhabditis elegans


Alignment Length:258 Identity:52/258 - (20%)
Similarity:98/258 - (37%) Gaps:62/258 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    80 IVLVVDALKYEFGLYRANAT-DPLPYENKLVVLQE------LLQQNPD------HARLMRFRAD- 130
            :||::      .||...:|. ||:. :|.:|:|.:      |....||      |......:.| 
 Worm     3 LVLIL------LGLVLGSAARDPIG-QNLIVILADGYGATLLNNTKPDATFGIRHLATNGVQVDY 60

  Fly   131 --P--PTTTLQRLKGLTTG--------SLPTFIDIGSNFASPEINEDNIIDQIVKND--LPVVFL 181
              |  ||.|..:...|:||        :.....|..:||........|..:.:..:|  .|:.:.
 Worm    61 VTPSFPTHTWPQWMSLSTGLYTENHGFTADYMWDRKTNFTFERGTGPNDTEDVWWDDAKAPLWYT 125

  Fly   182 GDSTWTDLYPHRFKRSYSYPSF-------------DIFDLDSVDN------EILKHLPKELESKD 227
            ......|::.:.|  ::.:.:|             ::.|....||      ||...:.|....|.
 Worm   126 AGKAGVDVHCYWF--AHCHRAFYDMVVQVPEKRWANLDDQHQTDNLRDIFPEIANRISKYQVYKQ 188

  Fly   228 WQVLVAHFLGVDHCGHKHGPMHEEMARKLGEMNEVIRSVVAAMD-----NDTTLLVMGDHGMT 285
             |:.:..:..:.:...:|||..:|:.:::...:..|..:...::     :.|.|:||.|||.|
 Worm   189 -QMFLIRYANIGNAQKEHGPESDEVEQEVARFDLYINELQQLLEDRGLFSSTNLVVMSDHGYT 250

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PIG-ONP_611332.1 GPI_EPT_3 74..349 CDD:293747 52/258 (20%)
T03G6.3NP_508470.1 Enpp 22..413 CDD:293742 45/232 (19%)
Phosphodiest 24..366 CDD:279931 44/230 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1524
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.