DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment PIG-O and enpp2

DIOPT Version :9

Sequence 1:NP_611332.1 Gene:PIG-O / 37118 FlyBaseID:FBgn0034346 Length:1077 Species:Drosophila melanogaster
Sequence 2:XP_009290357.1 Gene:enpp2 / 100332039 ZFINID:ZDB-GENE-040426-1156 Length:854 Species:Danio rerio


Alignment Length:240 Identity:53/240 - (22%)
Similarity:81/240 - (33%) Gaps:77/240 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly    79 VIVLVVDALKYEFGLYRANATDPLPYENKLVVLQELLQQNPDHARLMRFRADP--PTTTLQRLKG 141
            ||:|.||..:..: :.|.....|         ..|.|:....||..||    |  ||.|...|..
Zfish   161 VIMLSVDGFRASY-MKRGGTVIP---------NIEKLRSCGTHAPYMR----PMYPTKTYPNLYT 211

  Fly   142 LTTGSLP------------TFIDIGSNFASPE-INED---------NIIDQIVKNDLPVVFLGDS 184
            :|||..|            ...|...||...| :|..         ..:.|.||       .|..
Zfish   212 ITTGLYPESHGIVGNSIHDPSFDANFNFRGKEKLNHRWWGGQPIWITAMKQGVK-------AGSF 269

  Fly   185 TWTDLYPHRFKRSYSYPSFDIFDLDSVDNEILK-----HLPKELESKDWQVLVAHFLGVDHCGHK 244
            .|....|                   ::..:|.     |||   :::...:...|...:|..|||
Zfish   270 FWPVAIP-------------------MERRVLTMLQWLHLP---DAERPYLYAMHSEQLDSYGHK 312

  Fly   245 HGPMHEEMARKLGEMNEVIRSVV-----AAMDNDTTLLVMGDHGM 284
            .||...|:...|.::::||..::     ..:.....::::|||||
Zfish   313 LGPHSTELNSALRDVDKVIGQLMNGLKQMKLHRCINIILVGDHGM 357

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PIG-ONP_611332.1 GPI_EPT_3 74..349 CDD:293747 53/240 (22%)
enpp2XP_009290357.1 Somatomedin_B 52..91 CDD:279385
SO 98..137 CDD:197571
Enpp 159..512 CDD:293742 53/240 (22%)
Phosphodiest 161..472 CDD:279931 53/240 (22%)
NUC 589..846 CDD:238043
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1524
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.