DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5174 and TPD52L3

DIOPT Version :9

Sequence 1:NP_001246407.1 Gene:CG5174 / 37117 FlyBaseID:FBgn0034345 Length:369 Species:Drosophila melanogaster
Sequence 2:NP_277051.4 Gene:TPD52L3 / 89882 HGNCID:23382 Length:140 Species:Homo sapiens


Alignment Length:161 Identity:49/161 - (30%)
Similarity:73/161 - (45%) Gaps:33/161 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly   160 ASPANSVASAEIAAEFAALSVEEKEQRRAEWSQELARVEEEINTLRTVLASKTRHASDLKRKLGI 224
            |....||.:.|..:......:.|.|||  |...:|.::|.||.|||.|||:|.|...:||||||:
Human     4 ARTETSVGTYESHSTSELEDLTEPEQR--ELKTKLTKLEAEIVTLRHVLAAKERRCGELKRKLGL 66

  Fly   225 TVWKEVTDDVNQGLK-NLKESTVYQSVEQSVGTFTKTVYEAPLYQRTESVLKSTGEKTASVFGSI 288
            |..        .||: ||.:|  :..|:.| .|:.|                   :||::...::
Human    67 TAL--------VGLRQNLSKS--WLDVQVS-NTYVK-------------------QKTSAALSTM 101

  Fly   289 TSGISSKLSQMKNSESMRSIEASVGSAYENV 319
            .:.|..||..:|.|.:.||.|..:|:....|
Human   102 GTLICRKLGGVKKSATFRSFEGLMGTIKSKV 132

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5174NP_001246407.1 TPD52 158..314 CDD:282107 47/154 (31%)
TPD52L3NP_277051.4 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..28 5/23 (22%)
TPD52 6..136 CDD:367870 48/159 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165146211
Domainoid 1 1.000 54 1.000 Domainoid score I11225
eggNOG 1 0.900 - - E1_KOG4010
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 100 1.000 Inparanoid score I5001
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1225782at2759
OrthoFinder 1 1.000 - - FOG0000981
OrthoInspector 1 1.000 - - otm41657
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR19307
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
109.860

Return to query results.
Submit another query.