DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5174 and TPD52L1

DIOPT Version :9

Sequence 1:NP_001246407.1 Gene:CG5174 / 37117 FlyBaseID:FBgn0034345 Length:369 Species:Drosophila melanogaster
Sequence 2:NP_001305832.1 Gene:TPD52L1 / 7164 HGNCID:12006 Length:209 Species:Homo sapiens


Alignment Length:231 Identity:58/231 - (25%)
Similarity:104/231 - (45%) Gaps:66/231 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly   157 SEP--ASPANSVASAEIAAEFAALSVEEKEQRRAEWSQELARVEEEINTLRTVLASKTRHASDLK 219
            :||  .:..::||||:.:   :.||.||||:.:|    ||.::|:||.|||.||::|.||..::|
Human    11 TEPLQGTDEDAVASADFS---SMLSEEEKEELKA----ELVQLEDEITTLRQVLSAKERHLVEIK 68

  Fly   220 RKLGITVWKEVTDDVNQGLKNLKESTVYQSVEQSVGTFTKTVYEAPLYQRTESVLKSTGEKTASV 284
            :|||:.:..|:..:.::...:::.:|.                    |::|...|...|:|..:.
Human    69 QKLGMNLMNELKQNFSKSWHDMQTTTA--------------------YKKTHETLSHAGQKATAA 113

  Fly   285 FGSITSGISSK------------------LSQMKNSESMRSIEASVGSAYENVKVSYEHNNFMCQ 331
            |.::.:.||.|                  :..|:||.:.:|.|..|.:...::|           
Human   114 FSNVGTAISKKFGDMRSHSIGYSIRHSISMPAMRNSPTFKSFEERVETTVTSLK----------- 167

  Fly   332 SHATKVTSRSGSVSSFPDALDENNTSSGLNSPTDSL 367
               |||...:.:..||.:.|     ||..::...||
Human   168 ---TKVGGTNPNGGSFEEVL-----SSTAHASAQSL 195

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5174NP_001246407.1 TPD52 158..314 CDD:282107 47/175 (27%)
TPD52L1NP_001305832.1 TPD52 12..192 CDD:367870 56/225 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165146209
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4010
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 100 1.000 Inparanoid score I5001
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1225782at2759
OrthoFinder 1 1.000 - - FOG0000981
OrthoInspector 1 1.000 - - otm41657
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR19307
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R4903
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
1110.890

Return to query results.
Submit another query.