DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5174 and TPD52

DIOPT Version :9

Sequence 1:NP_001246407.1 Gene:CG5174 / 37117 FlyBaseID:FBgn0034345 Length:369 Species:Drosophila melanogaster
Sequence 2:NP_001374707.1 Gene:TPD52 / 7163 HGNCID:12005 Length:261 Species:Homo sapiens


Alignment Length:156 Identity:53/156 - (33%)
Similarity:86/156 - (55%) Gaps:31/156 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly   170 EIAAEFAA---LSVEEKEQRRAEWSQELARVEEEINTLRTVLASKTRHASDLKRKLGITVWKEVT 231
            ::||..:|   ||.||:|:.|    :|||:|||||.||..|||:|.:|.:::||||||...:|:.
Human    20 DVAATISATETLSEEEQEELR----RELAKVEEEIQTLSQVLAAKEKHLAEIKRKLGINSLQELK 80

  Fly   232 DDVNQGLKNLKESTVYQSVEQSVGTFTKTVYEAPLYQRTESVLKSTGEKTASVFGSITSGISSKL 296
            .::.:|.:::..::.                    |::|...|...|:|.::.|.|:.|.|:.||
Human    81 QNIAKGWQDVTATSA--------------------YKKTSETLSQAGQKASAAFSSVGSVITKKL 125

  Fly   297 SQMKNSESMRSIEASVGSAYENVKVS 322
            ..:|||.:.:|.|..|    ||:|.|
Human   126 EDVKNSPTFKSFEEKV----ENLKGS 147

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5174NP_001246407.1 TPD52 158..314 CDD:282107 49/146 (34%)
TPD52NP_001374707.1 TPD52 12..145 CDD:398052 51/152 (34%)
MRP-S35 148..252 CDD:402037 53/156 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165146212
Domainoid 1 1.000 54 1.000 Domainoid score I11225
eggNOG 1 0.900 - - E1_KOG4010
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 100 1.000 Inparanoid score I5001
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1225782at2759
OrthoFinder 1 1.000 - - FOG0000981
OrthoInspector 1 1.000 - - otm41657
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR19307
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R4903
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
1211.890

Return to query results.
Submit another query.