DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5174 and Tpd52l1

DIOPT Version :9

Sequence 1:NP_001246407.1 Gene:CG5174 / 37117 FlyBaseID:FBgn0034345 Length:369 Species:Drosophila melanogaster
Sequence 2:XP_006227801.1 Gene:Tpd52l1 / 689256 RGDID:1594796 Length:209 Species:Rattus norvegicus


Alignment Length:230 Identity:56/230 - (24%)
Similarity:102/230 - (44%) Gaps:67/230 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly   157 SEP--ASPANSVASAEIAAEFAALSVEEKEQRRAEWSQELARVEEEINTLRTVLASKTRHASDLK 219
            :||  ....:::.||:::   :.||.|||::.:|    ||.::||||.|||.||::|.||..::|
  Rat    11 TEPLQGRDGDAIGSADLS---SMLSEEEKDELKA----ELVQLEEEITTLRQVLSAKERHLVEIK 68

  Fly   220 RKLGITVWKEVTDDVNQGLKNLKESTVYQSVEQSVGTFTKTVYEAPLYQRTESVLKSTGEKTASV 284
            :|||:.:..|:..:.::...:::.:|.                    |::|...|...|:|..:.
  Rat    69 QKLGMNLMNELKQNFSRSWHDMQTTTA--------------------YKKTHETLSHAGQKATAA 113

  Fly   285 FGSITSGISSK------------------LSQMKNSESMRSIEASVGSAYENVKVSYEHNNFMCQ 331
            |.::.:.||.|                  :..|:||.:.:|.|..|.:...::|           
  Rat   114 FSNVGTAISRKFGDMRSHSIGYSIRHSISMPAMRNSPTFKSFEERVETTVTSLK----------- 167

  Fly   332 SHATKVTSRSGSVSSFPDAL------DENNTSSGL 360
               |||...:.|..||.:.|      ...|.|:|:
  Rat   168 ---TKVGGTNHSGGSFEEVLSSTAHASSQNASAGI 199

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5174NP_001246407.1 TPD52 158..314 CDD:282107 45/175 (26%)
Tpd52l1XP_006227801.1 TPD52 12..192 CDD:282107 53/220 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166339975
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4010
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 91 1.000 Inparanoid score I5011
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1225782at2759
OrthoFinder 1 1.000 - - FOG0000981
OrthoInspector 1 1.000 - - otm45779
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR19307
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
109.860

Return to query results.
Submit another query.