DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5174 and tpd52l2

DIOPT Version :9

Sequence 1:NP_001246407.1 Gene:CG5174 / 37117 FlyBaseID:FBgn0034345 Length:369 Species:Drosophila melanogaster
Sequence 2:XP_031749993.1 Gene:tpd52l2 / 595067 XenbaseID:XB-GENE-6453983 Length:317 Species:Xenopus tropicalis


Alignment Length:317 Identity:84/317 - (26%)
Similarity:148/317 - (46%) Gaps:53/317 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    74 LELQAVEADFIAAKLANQAPSSSMAKRFRLKFFAKRTMRDVKVTF-----IDFSKPYLAKISNSD 133
            :|::|...|  .|.:..|..:::..:|           :||.:|.     :||.|.     :...
 Frog    31 IEIKANRKD--GADMLIQETTTTQQRR-----------QDVTLTHLHAYCVDFRKQ-----ATPS 77

  Fly   134 NYKRF------------LNIGHRSRGTKFDNTANLSEPASPANSVASAEIAAEFAALSVEE--KE 184
            .|:::            :|:...::|...|..|::  |..||...|.|:.    |.::|.|  .|
 Frog    78 CYRQYPVNGDMEPGGQDINLNSPNKGLLTDYGADV--PVLPAGGHAPADA----AGMAVPEGLTE 136

  Fly   185 QRRAEWSQELARVEEEINTLRTVLASKTRHASDLKRKLGITVWKEVTDDVNQGLKNLKESTVYQS 249
            ....|...||.:|||||||||.|||:|.|||::||||||.|...::..::::.|:.::.|..|..
 Frog   137 AETEELHSELLKVEEEINTLRQVLAAKERHAAELKRKLGQTPLNQLKMNLSKSLQEVQMSNAYVK 201

  Fly   250 VEQSVGTFTKTVYEAPLYQRTESVLKSTGEKTASVFGSITSGISSKLSQMKN---SESMRSIEAS 311
            ..:..|.:.:.|.::.:|::|:..|...|:||::...::.:.|:.:|..|:.   |:|..|.   
 Frog   202 TSEKFGEWNEKVTQSDVYKKTQETLSQAGQKTSAALSNVGTAITRRLGDMRALPFSQSFSSY--- 263

  Fly   312 VGSAYENVKVSYEHNNFMCQSHATKVTSRSGSVSSFPDALDENNTSSGLNSPTDSLP 368
              |...::.:....|:...:|...:|.|..|.||.  ...:..|..|..|:|.||.|
 Frog   264 --SIRHSISMPAMRNSPTFKSFEERVGSLKGRVSL--GGGESGNFHSPDNNPQDSAP 316

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5174NP_001246407.1 TPD52 158..314 CDD:282107 52/160 (33%)
tpd52l2XP_031749993.1 TPD52 134..307 CDD:398052 53/179 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 58 1.000 Domainoid score I10597
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 96 1.000 Inparanoid score I4909
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1225782at2759
OrthoFinder 1 1.000 - - FOG0000981
OrthoInspector 1 1.000 - - otm48872
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X5007
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
66.060

Return to query results.
Submit another query.