DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5174 and AgaP_AGAP004869

DIOPT Version :9

Sequence 1:NP_001246407.1 Gene:CG5174 / 37117 FlyBaseID:FBgn0034345 Length:369 Species:Drosophila melanogaster
Sequence 2:XP_001688560.1 Gene:AgaP_AGAP004869 / 5667364 VectorBaseID:AGAP004869 Length:159 Species:Anopheles gambiae


Alignment Length:154 Identity:74/154 - (48%)
Similarity:96/154 - (62%) Gaps:19/154 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MSESEPNSLEFIEDPYLPSIDDLTSTPSL----DLETNDAVLDWYGDGQEE----SEAELYLRNL 57
            :.|.:..|||:|||||:|.:|....||||    |::.:|.::     |.||    .|.|||||:|
Mosquito     3 VGEDDLPSLEYIEDPYIPKLDPNCFTPSLDEVYDIDEDDGLI-----GHEEQHWSDETELYLRSL 62

  Fly    58 TLDQIF----YDVDSDYTNSLELQAVEADFIAAKLANQAPSSSMAKRFRLKFFAKRTMRDVKVTF 118
            |||||.    .|.|.|.|:.:|||.||.:| ...|:.....|:..:|.| ..|.:|.:|||:|||
Mosquito    63 TLDQILGVPSDDEDIDPTSEVELQTVETEF-NPPLSKLLLGSATNRRIR-ALFNRRKIRDVRVTF 125

  Fly   119 IDFSKPYLAKISNSDNYKRFLNIG 142
            |||||||||:||:.||||.|||||
Mosquito   126 IDFSKPYLARISSGDNYKSFLNIG 149

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5174NP_001246407.1 TPD52 158..314 CDD:282107
AgaP_AGAP004869XP_001688560.1 None
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 117 1.000 Domainoid score I11611
eggNOG 1 0.900 - - E1_KOG4010
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000981
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.810

Return to query results.
Submit another query.