DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5174 and tpd52

DIOPT Version :9

Sequence 1:NP_001246407.1 Gene:CG5174 / 37117 FlyBaseID:FBgn0034345 Length:369 Species:Drosophila melanogaster
Sequence 2:XP_005159684.1 Gene:tpd52 / 559992 ZFINID:ZDB-GENE-060503-680 Length:246 Species:Danio rerio


Alignment Length:263 Identity:63/263 - (23%)
Similarity:108/263 - (41%) Gaps:57/263 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly   120 DFSKPYLAKISNSDNYKRFLNIGHRSRGTKFDNTANLSEPASPANSVASAEIAAEFAALSVEE-- 182
            |:..|:        |:::.:|..:.....| ::......|..|.......:...|....:|:.  
Zfish     7 DYKSPF--------NFEQGVNTSYLYLSPK-ESFTPPGSPVPPLRGTQRPDFIQEVGEEAVDAAP 62

  Fly   183 -------KEQRRAEWSQELARVEEEINTLRTVLASKTRHASDLKRKLGITVWKEVTDDVNQGLKN 240
                   .||.:||...||.:|||||.||..|||:|.:..:::|||||||...|:..::::|..:
Zfish    63 CSPCTVLTEQEQAELHSELQKVEEEIQTLSQVLAAKEKQVAEIKRKLGITPLNELKQNLSKGWHD 127

  Fly   241 LKESTVYQSVEQSVGTFTKTVYEAPLYQRTESVLKSTGEKTASVFGSITSGISSKLSQMK----- 300
            :..||.                    |::|...|...|:|..:.|.|:.:.|:.||..::     
Zfish   128 VTTSTA--------------------YKKTSETLSQVGQKATTAFSSVGTAITRKLEDVRLQSFS 172

  Fly   301 NSESMRSIEASVGSAYENVKVSYEHNNFMCQSHATKVTSRSGSVSSFPDALDENNTSSGLNSPTD 365
            ||..:|||:.|       ..:....|....:|...||.:....:|..|       ::|.:...:|
Zfish   173 NSFGIRSIQHS-------ASMPVMRNTPSFKSFEEKVETLKTKMSPKP-------STSDIEEVSD 223

  Fly   366 SLP 368
            |.|
Zfish   224 STP 226

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5174NP_001246407.1 TPD52 158..314 CDD:282107 48/169 (28%)
tpd52XP_005159684.1 TPD52 48..229 CDD:282107 56/213 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170579787
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1225782at2759
OrthoFinder 1 1.000 - - FOG0000981
OrthoInspector 1 1.000 - - otm25094
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR19307
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R4903
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
ZFIN 00.000 Not matched by this tool.
98.940

Return to query results.
Submit another query.