DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5174 and tpd52l1

DIOPT Version :9

Sequence 1:NP_001246407.1 Gene:CG5174 / 37117 FlyBaseID:FBgn0034345 Length:369 Species:Drosophila melanogaster
Sequence 2:XP_005160876.1 Gene:tpd52l1 / 553769 ZFINID:ZDB-GENE-050522-121 Length:229 Species:Danio rerio


Alignment Length:191 Identity:59/191 - (30%)
Similarity:93/191 - (48%) Gaps:31/191 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly   184 EQRRAEWSQELARVEEEINTLRTVLASKTRHASDLKRKLGITVWKEVTDDVNQGLKNLKESTVYQ 248
            |:.|.|...||.::||||.||:.|||||.:...:||:|||||...|:..:.|:...:::.||||:
Zfish    55 EEEREEMENELTKLEEEITTLKQVLASKEKRHLELKQKLGITALSELRHNFNKSWNDMQTSTVYK 119

  Fly   249 SVEQSVGTFTKTVYEAPLYQRTESVLKSTGEKTASVFGSITS---GISSKLSQ----MKNSESMR 306
            ...:::.|         ..|||.:...:.|...:..||.:.|   |.|.:.|.    |:||.|.:
Zfish   120 KTSETLST---------AGQRTSAAFSNLGTAISRKFGDMRSYSIGYSVRHSMSMPAMRNSPSFK 175

  Fly   307 SIEASVGSAYENVKVSYEHNNFMCQSHATKVTSRSGSVSSFPDALDENNTSSGLNSPTDSL 367
            |.|..|.|...|:|              :|| ..:|...||.:.|.....:|..::||:::
Zfish   176 SFEEKVESTVSNIK--------------SKV-GGTGGAGSFEEVLSSAAHASAQDTPTNNV 221

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5174NP_001246407.1 TPD52 158..314 CDD:282107 47/136 (35%)
tpd52l1XP_005160876.1 TPD52 34..213 CDD:282107 56/181 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170579784
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4010
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1225782at2759
OrthoFinder 1 1.000 - - FOG0000981
OrthoInspector 1 1.000 - - otm25094
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR19307
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R4903
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
ZFIN 00.000 Not matched by this tool.
1110.840

Return to query results.
Submit another query.