DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5174 and tpd52l2a

DIOPT Version :9

Sequence 1:NP_001246407.1 Gene:CG5174 / 37117 FlyBaseID:FBgn0034345 Length:369 Species:Drosophila melanogaster
Sequence 2:XP_005167067.1 Gene:tpd52l2a / 335107 ZFINID:ZDB-GENE-030131-7047 Length:219 Species:Danio rerio


Alignment Length:246 Identity:67/246 - (27%)
Similarity:105/246 - (42%) Gaps:72/246 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly   160 ASPANSVASAEIAAEFA---ALSVEEKEQRRAEWSQELARVEEEINTLRTVLASKTRHASDLKRK 221
            :|...|..:|.|||...   .::.||.|    |...||.:||:||.|||.||.:|.|||::||.:
Zfish     3 SSEQGSSMNAGIAAGMTLPPGVTEEEAE----EMQMELIKVEDEIETLRQVLVAKERHAAELKHR 63

  Fly   222 LGITVWKEVTDDVNQGLKNLKESTVYQSVEQSVGTFTKTVYEAPL----------------YQRT 270
            |||:...|:..::.:|..:::.|..|....|::|...:.|..:.|                |:||
Zfish    64 LGISPLSEIKQNITKGWHDVQCSNAYMRTSQTLGDLNRRVTSSNLYLTASATLEDIGRSDAYKRT 128

  Fly   271 ESVLKSTGEKTASVFGSITSGISSKLSQ-----------------------MKNSESMRSIEASV 312
            :..|...|:.|::.|.|:.|.|.|:..:                       |:||.|.:|.|..|
Zfish   129 QETLSQAGQVTSAAFSSMGSAIRSRFGEMRALPYSDSGSNLSMRHSLSMPAMRNSPSFKSFEDKV 193

  Fly   313 GSAYENVKVSYEHNNFMCQSHATKVTSRSGSVSSFPDALDENNTSSGLNSP 363
                ||:|.              ||..|:...:      |.:.||:  |:|
Zfish   194 ----ENMKY--------------KVMGRANGEN------DHSPTSN--NAP 218

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5174NP_001246407.1 TPD52 158..314 CDD:282107 56/195 (29%)
tpd52l2aXP_005167067.1 TPD52 <36..218 CDD:282107 55/207 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170579786
Domainoid 1 1.000 61 1.000 Domainoid score I10445
eggNOG 1 0.900 - - E1_KOG4010
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1225782at2759
OrthoFinder 1 1.000 - - FOG0000981
OrthoInspector 1 1.000 - - otm25094
orthoMCL 1 0.900 - - OOG6_107924
Panther 1 1.100 - - O PTHR19307
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R17289
SonicParanoid 1 1.000 - - X5007
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
ZFIN 00.000 Not matched by this tool.
1312.740

Return to query results.
Submit another query.