Sequence 1: | NP_001246407.1 | Gene: | CG5174 / 37117 | FlyBaseID: | FBgn0034345 | Length: | 369 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | XP_021325415.1 | Gene: | tpd52l2b / 322103 | ZFINID: | ZDB-GENE-030131-822 | Length: | 245 | Species: | Danio rerio |
Alignment Length: | 228 | Identity: | 61/228 - (26%) |
---|---|---|---|
Similarity: | 107/228 - (46%) | Gaps: | 52/228 - (22%) |
- Green bases have known domain annotations that are detailed below.
Fly 133 DNYKRFLNIGHRSRGTKFDNTANLSEPASPANSVASAEIAAEFAALSVEEKEQRRAEWSQELARV 197
Fly 198 EEEINTLRTVLASKTRHASDLKRKLGITVWKEVTDDVNQGLKNLKESTVYQSVEQSVGTFTKTV- 261
Fly 262 ---------------YEAPLYQRTESVLKSTGEKTASVFGSITSGISSKLSQ------------- 298
Fly 299 -----------MKNSESMRSIEASVGSAYENVK 320 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
CG5174 | NP_001246407.1 | TPD52 | 158..314 | CDD:282107 | 53/195 (27%) |
tpd52l2b | XP_021325415.1 | TPD52 | <56..233 | CDD:309362 | 46/166 (28%) |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 1 | 0.930 | - | - | C170579785 | |
Domainoid | 1 | 1.000 | 61 | 1.000 | Domainoid score | I10445 |
eggNOG | 1 | 0.900 | - | - | E1_KOG4010 | |
Hieranoid | 1 | 1.000 | - | - | ||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 1 | 1.010 | - | - | D1225782at2759 | |
OrthoFinder | 1 | 1.000 | - | - | FOG0000981 | |
OrthoInspector | 1 | 1.000 | - | - | otm25094 | |
orthoMCL | 1 | 0.900 | - | - | OOG6_107924 | |
Panther | 1 | 1.100 | - | - | LDO | PTHR19307 |
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 1 | 1.030 | - | avgDist | Average_Evolutionary_Distance | R4903 |
SonicParanoid | 1 | 1.000 | - | - | X5007 | |
SwiftOrtho | 1 | 1.000 | - | - | ||
TreeFam | 1 | 0.960 | - | - | ||
ZFIN | 0 | 0.000 | Not matched by this tool. | |||
14 | 13.740 |