DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5174 and tpd52l2b

DIOPT Version :9

Sequence 1:NP_001246407.1 Gene:CG5174 / 37117 FlyBaseID:FBgn0034345 Length:369 Species:Drosophila melanogaster
Sequence 2:XP_021325415.1 Gene:tpd52l2b / 322103 ZFINID:ZDB-GENE-030131-822 Length:245 Species:Danio rerio


Alignment Length:228 Identity:61/228 - (26%)
Similarity:107/228 - (46%) Gaps:52/228 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly   133 DNYKRFLNIGHRSRGTKFDNTANLSEPASPANSVASAEIAAEFAALSVEEKEQRRAEWSQELARV 197
            |...:.:|:....:|...|:.::|.|....| :|:...:.   ..|:.||.|:.|.    ||.:|
Zfish     2 DTANQDINLNSPHKGLGSDSISDLPEERGAA-AVSPGTLP---PGLTEEEAEELRL----ELTKV 58

  Fly   198 EEEINTLRTVLASKTRHASDLKRKLGITVWKEVTDDVNQGLKNLKESTVYQSVEQSVGTFTKTV- 261
            ||||||||.||::|.||||:||||||::...|...::.:..::::.|..|.::.:.:|.:.:.| 
Zfish    59 EEEINTLRQVLSAKERHASELKRKLGLSPLTEFKQNITKSWQDVQTSNAYVTMSEKLGQWNEKVK 123

  Fly   262 ---------------YEAPLYQRTESVLKSTGEKTASVFGSITSGISSKLSQ------------- 298
                           ..:.:|::|:..|...|:||::...::.:.||.||..             
Zfish   124 GCDIYLSASSTLDDITSSEVYKKTQETLSQAGQKTSAALSTVGTAISRKLGDMRALPFSNSFGSN 188

  Fly   299 -----------MKNSESMRSIEASVGSAYENVK 320
                       |:||.:.:|.|..||    |:|
Zfish   189 YSIRHSISMPTMRNSPTFKSFEDKVG----NIK 217

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5174NP_001246407.1 TPD52 158..314 CDD:282107 53/195 (27%)
tpd52l2bXP_021325415.1 TPD52 <56..233 CDD:309362 46/166 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170579785
Domainoid 1 1.000 61 1.000 Domainoid score I10445
eggNOG 1 0.900 - - E1_KOG4010
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1225782at2759
OrthoFinder 1 1.000 - - FOG0000981
OrthoInspector 1 1.000 - - otm25094
orthoMCL 1 0.900 - - OOG6_107924
Panther 1 1.100 - - LDO PTHR19307
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R4903
SonicParanoid 1 1.000 - - X5007
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
ZFIN 00.000 Not matched by this tool.
1413.740

Return to query results.
Submit another query.