DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5174 and Tpd52

DIOPT Version :9

Sequence 1:NP_001246407.1 Gene:CG5174 / 37117 FlyBaseID:FBgn0034345 Length:369 Species:Drosophila melanogaster
Sequence 2:XP_038957887.1 Gene:Tpd52 / 294900 RGDID:1306767 Length:362 Species:Rattus norvegicus


Alignment Length:161 Identity:55/161 - (34%)
Similarity:86/161 - (53%) Gaps:30/161 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly   157 SEPASPANSVASAEIAAEFAALSVEEKEQRRAEWSQELARVEEEINTLRTVLASKTRHASDLKRK 221
            :||.:.....|.|.::|. ..|:.||:|:.|    :||.:|||||.||..|||:|.:|.:::|||
  Rat   165 TEPVAEEGEDAVAMLSAP-ETLTEEEQEELR----RELTKVEEEIQTLSQVLAAKEKHLAEIKRK 224

  Fly   222 LGITVWKEVTDDVNQGLKNLKESTVYQSVEQSVGTFTKTVYEAPLYQRTESVLKSTGEKTASVFG 286
            ||||..:|...::.:|         :|.|     |.|..      |::|...|...|:|.::.|.
  Rat   225 LGITSLQEFKQNIAKG---------WQDV-----TATNA------YKKTSETLSQAGQKASAAFS 269

  Fly   287 SITSGISSKLSQMK-----NSESMRSIEASV 312
            |:.|.|:.||..:|     :|.|:|||:.|:
  Rat   270 SVGSVITKKLEDVKLQAFSHSFSIRSIQHSI 300

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5174NP_001246407.1 TPD52 158..314 CDD:282107 55/160 (34%)
Tpd52XP_038957887.1 TPD52 <198..330 CDD:398052 43/123 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166339979
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4010
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 91 1.000 Inparanoid score I5011
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1225782at2759
OrthoFinder 1 1.000 - - FOG0000981
OrthoInspector 1 1.000 - - otm45779
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR19307
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
109.900

Return to query results.
Submit another query.