DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5174 and Tpd52l3

DIOPT Version :9

Sequence 1:NP_001246407.1 Gene:CG5174 / 37117 FlyBaseID:FBgn0034345 Length:369 Species:Drosophila melanogaster
Sequence 2:XP_006231322.1 Gene:Tpd52l3 / 293894 RGDID:1309391 Length:243 Species:Rattus norvegicus


Alignment Length:219 Identity:58/219 - (26%)
Similarity:92/219 - (42%) Gaps:40/219 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly   155 NLSEPASPANSVASAEIAA---EFAALSVEE-KEQRRAEWSQELARVEEEINTLRTVLASKTRHA 215
            :|:|..|.:.|.|..|.:|   ||...|..: .|..:.|...||.::||||.:||.:||:|.:..
  Rat    47 SLNEDLSLSVSDAMTETSASTNEFHLASEPDLTEAEQMELRSELTKLEEEILSLRDLLAAKEKRC 111

  Fly   216 SDLKRKLGITVWKEVTDDVNQGLKNLKESTVYQSVEQSVGTFTKTVYEAPLYQRTESVLKSTGEK 280
            .:||||||......:..::::...:::.|..|..                             :|
  Rat   112 GELKRKLGCVALVGLRQNLSKSWHDVQASNTYMK-----------------------------QK 147

  Fly   281 TASVFGSITSGISSKLSQMKNSESMRSIEASVGSAYENVKVSYEHNNFMCQSHATKVTSRSGSVS 345
            |::...|:.|.|..||..||.|.:.:|:|..||:....|....|..:.:..|.|:.....|...|
  Rat   148 TSTALASMGSAICRKLGDMKKSSTFKSLEELVGTVKSRVAGGRELGSGLLPSPASGSDPHSVLGS 212

  Fly   346 SFPDALDENNTSSGLNSPTDSLPK 369
            .:       .|.|||:....||.|
  Rat   213 GY-------ETVSGLDDQLFSLLK 229

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5174NP_001246407.1 TPD52 158..314 CDD:282107 43/159 (27%)
Tpd52l3XP_006231322.1 TPD52 58..205 CDD:282107 45/175 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166339977
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4010
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 91 1.000 Inparanoid score I5011
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1225782at2759
OrthoFinder 1 1.000 - - FOG0000981
OrthoInspector 1 1.000 - - otm45779
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR19307
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
109.860

Return to query results.
Submit another query.