DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5174 and Tpd52

DIOPT Version :9

Sequence 1:NP_001246407.1 Gene:CG5174 / 37117 FlyBaseID:FBgn0034345 Length:369 Species:Drosophila melanogaster
Sequence 2:NP_001344001.1 Gene:Tpd52 / 21985 MGIID:107749 Length:316 Species:Mus musculus


Alignment Length:217 Identity:63/217 - (29%)
Similarity:107/217 - (49%) Gaps:32/217 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly   157 SEPASPANSVASAEIAAEFAALSVEEKEQRRAEWSQELARVEEEINTLRTVLASKTRHASDLKRK 221
            :||.:.....|...::|. .||:.||:|:.|    :||.:|||||.||..|||:|.:|.::||||
Mouse   119 TEPVAEEGEDAVTMLSAP-EALTEEEQEELR----RELTKVEEEIQTLSQVLAAKEKHLAELKRK 178

  Fly   222 LGITVWKEVTDDVNQGLKNLKESTVYQSVEQSVGTFTKTVYEAPLYQRTESVLKSTGEKTASVFG 286
            |||:..:|...::.:|         :|.|     |.|..      |::|...|...|:|.::.|.
Mouse   179 LGISSLQEFKQNIAKG---------WQDV-----TATNA------YKKTSETLSQAGQKASAAFS 223

  Fly   287 SITSGISSKLSQMK-----NSESMRSIEASVGSAYENVKVSYEHNNFMCQSHATKVTSRSGSVSS 346
            |:.|.|:.||..:|     :|.|:|||:.|:.........:::......::..:||.....:...
Mouse   224 SVGSVITKKLEDVKLQAFSHSFSIRSIQHSISMPAMRNSPTFKSFEEKVENLKSKVGGAKPAGGD 288

  Fly   347 FPDALDENNTSSGLNSPTDSLP 368
            |.:.|  |:|::..::.|...|
Mouse   289 FGEVL--NSTANATSTMTTEPP 308

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5174NP_001246407.1 TPD52 158..314 CDD:282107 55/160 (34%)
Tpd52NP_001344001.1 TPD52 <152..301 CDD:309362 49/170 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167836313
Domainoid 1 1.000 57 1.000 Domainoid score I10835
eggNOG 1 0.900 - - E1_KOG4010
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 80 1.000 Inparanoid score I5198
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1225782at2759
OrthoFinder 1 1.000 - - FOG0000981
OrthoInspector 1 1.000 - - otm43702
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR19307
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R4903
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
1312.890

Return to query results.
Submit another query.