DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5174 and tpd52l1

DIOPT Version :9

Sequence 1:NP_001246407.1 Gene:CG5174 / 37117 FlyBaseID:FBgn0034345 Length:369 Species:Drosophila melanogaster
Sequence 2:XP_002936056.2 Gene:tpd52l1 / 100487402 XenbaseID:XB-GENE-961168 Length:210 Species:Xenopus tropicalis


Alignment Length:222 Identity:54/222 - (24%)
Similarity:94/222 - (42%) Gaps:72/222 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly   170 EIAAEF---AALSVEEKEQRRAEWSQELARVEEEINTLRTVLASKTRHASDLKRKLGITVWKEVT 231
            |:|.:.   ..:|.||||    |...||.::|.||.|||.|||:|.:|..::|:|||:::..|:.
 Frog    21 ELATDIDYSETISEEEKE----ELKSELFKLENEIVTLRQVLAAKEKHLVEIKQKLGVSMMNELK 81

  Fly   232 DDVNQGLKNLKESTVYQSVEQSVGTFTKTVYEAPLYQRTESVLKSTGEKTASVFGSITSGISSKL 296
            .:.::...:::..:.                    |::|:..|...|.|..:...::.|.|..||
 Frog    82 QNFSRSWHDVQTHSA--------------------YKKTQETLSQAGLKATAAITNVGSAIGKKL 126

  Fly   297 SQ------------------MKNSESMRSIE-----------ASVGSA------YENVKVSYEHN 326
            ..                  |:||.:.:|.|           |.||||      :|.|..|    
 Frog   127 GDMRSHSISYSIRHSISMPAMRNSPTFKSFEERVENTVTTLRAKVGSANQTQGSFEEVLSS---- 187

  Fly   327 NFMCQSHATKVTSRSGSVSSFPDALDE 353
                .:||:..:|.:|::  .|:|.::
 Frog   188 ----TAHASAHSSLAGTL--LPEAEED 208

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5174NP_001246407.1 TPD52 158..314 CDD:282107 42/175 (24%)
tpd52l1XP_002936056.2 TPD52 13..193 CDD:367870 50/203 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 96 1.000 Inparanoid score I4909
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1225782at2759
OrthoFinder 1 1.000 - - FOG0000981
OrthoInspector 1 1.000 - - otm48872
Panther 1 1.100 - - O PTHR19307
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R4903
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
88.100

Return to query results.
Submit another query.