DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5174 and abhd6

DIOPT Version :9

Sequence 1:NP_001246407.1 Gene:CG5174 / 37117 FlyBaseID:FBgn0034345 Length:369 Species:Drosophila melanogaster
Sequence 2:NP_001120619.1 Gene:abhd6 / 100145783 XenbaseID:XB-GENE-966285 Length:338 Species:Xenopus tropicalis


Alignment Length:100 Identity:22/100 - (22%)
Similarity:43/100 - (43%) Gaps:11/100 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    65 DVDSDYTNSLELQAVEADFIAAKLANQAPSSS--MAKRFRLKFFAK-RTMRDVKVTFIDFSKPYL 126
            |..:|.|....|:.:|......:.....||::  |.:..||..|.: :..:.|....:|      
 Frog   177 DYPNDSTFLKHLKGLEKSSPDDQRIPLIPSTATEMQEMLRLCSFVRFKIPQQVLQGLVD------ 235

  Fly   127 AKISNSDNYKR-FLN-IGHRSRGTKFDNTANLSEP 159
            .:|.:::.|:| ||. :..:||.:..:|...:..|
 Frog   236 VRIPHNEFYRRLFLALVDEKSRHSLHENMGKIVAP 270

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5174NP_001246407.1 TPD52 158..314 CDD:282107 0/1 (0%)
abhd6NP_001120619.1 MhpC 52..328 CDD:223669 21/99 (21%)
Abhydrolase 70..>160 CDD:304388
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165165800
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.