DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5174 and tpd52

DIOPT Version :9

Sequence 1:NP_001246407.1 Gene:CG5174 / 37117 FlyBaseID:FBgn0034345 Length:369 Species:Drosophila melanogaster
Sequence 2:XP_031759063.1 Gene:tpd52 / 100135218 XenbaseID:XB-GENE-961292 Length:233 Species:Xenopus tropicalis


Alignment Length:262 Identity:72/262 - (27%)
Similarity:111/262 - (42%) Gaps:61/262 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly   120 DFSKPYLAKISNSDNYKRFLNIGHRSRGTKFDNTANLSEPASPANSVASAE--IAAEFAALSVEE 182
            |:..|:......:.||   |.:..|...|..|:...|........|:...|  .|.|...||.||
 Frog    11 DYKSPFNFDSGVNTNY---LYLSPRPNATPPDSPTLLRADLLKPESIPEGEDVAAPELETLSEEE 72

  Fly   183 KEQRRAEWSQELARVEEEINTLRTVLASKTRHASDLKRKLGITVWKEVTDDVNQGLKNLKESTVY 247
            :|:.:    :||.:|||||.||..|||:|.:|.:|:|||||:|...|:..::::||.::..:|| 
 Frog    73 QEKLK----KELEKVEEEIQTLSQVLAAKEKHHADIKRKLGVTALSELKQNISKGLHDVASTTV- 132

  Fly   248 QSVEQSVGTFTKTVYEAPLYQRTESVLKSTGEKTASVFGSITSGISSKLSQ-------------- 298
                               |:||...|...|:|.::.|.|:.|.|:.||..              
 Frog   133 -------------------YKRTSETLSHAGQKASAAFSSVGSVITKKLEDVNIRSIQHSISMPA 178

  Fly   299 MKNSESMRSIEASVGSAYENVKVSYEHNNFMCQSHATKVTSRSGSVSSFPDALDENNTSSGLNSP 363
            |:||.:.:|.|..|    ||:|              :||.....|...|.:.|:....:|.....
 Frog   179 MRNSPTYKSFEERV----ENLK--------------SKVGGNRQSTGDFEEVLNSAANASATEPL 225

  Fly   364 TD 365
            |:
 Frog   226 TE 227

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5174NP_001246407.1 TPD52 158..314 CDD:282107 53/171 (31%)
tpd52XP_031759063.1 TPD52 <87..221 CDD:398052 46/171 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 58 1.000 Domainoid score I10597
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1225782at2759
OrthoFinder 1 1.000 - - FOG0000981
OrthoInspector 1 1.000 - - otm48872
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
44.010

Return to query results.
Submit another query.