DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Dp1 and Bicc1

DIOPT Version :9

Sequence 1:NP_001286573.1 Gene:Dp1 / 37116 FlyBaseID:FBgn0027835 Length:1301 Species:Drosophila melanogaster
Sequence 2:NP_113574.1 Gene:Bicc1 / 83675 MGIID:1933388 Length:977 Species:Mus musculus


Alignment Length:424 Identity:97/424 - (22%)
Similarity:160/424 - (37%) Gaps:147/424 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly   560 PTPQENTDIVK----LRGPKEDVDKCHKDLLKLVKEIQESSHIIEVPIFKQFHKFVIGKGGAN-- 618
            |......|:|.    |..|:...::...|..||...:|.::.               |||.:.  
Mouse    28 PVAGSEDDLVAAAPLL
HSPEWSEERFRVDRKKLEAMLQAAAE---------------GKGRSGED 77

  Fly   619 -IKKIRDETQTKIDLP------AEGDTNEVIVITGKKENVLEAKERIQKIQNELSDIVTEEVQIP 676
             .:||.:||.|:|..|      |:...:..|.::||||:|.||||.|..:.:..|:.||.::.:.
Mouse    78 FFQKIMEETNTQIAWPSKLKIGAKSKKDPHIKVSGKKEDVKEAKEMIMSVLDTKSNRVTLKMDVS 142

  Fly   677 PKYYNSIIGTGGKLISSIMEECGGVSIKFPNSD-----SKSDKVTIRGPKDDVEKAKVQLLEL-- 734
            ...::.:||.||..|..:||:. |..|.||:|:     .||::|:|.|....||.|:.::.||  
Mouse   143 HTEHSHVIGKGGNNIKKVMEDT-GCHIHFPDSNRNNQAEKSNQVSIAGQPAGVESARARIRELLP 206

  Fly   735 -------------------------------------ANERQLASFTAEVRAKQ----------- 751
                                                 ....::...|..||..|           
Mouse   207 LVLMFELPIAGILQPVPDPNTPSIQHISQTYSVSVSFKQRSRMYGATVTVRGSQNNTNAVKEGTA 271

  Fly   752 ------------------------QHHKFLIGKNGASIRKIRDATGARIIFPSNEDTDKE-VITI 791
                                    |||.|::|:||::::.|...|||:|.||...:..|: .:.:
Mouse   272 MLLEHLAGSLASAIPVSTQLDIAAQHHLFMMGRNGSNVKHIMQRTGAQIHFPDPSNPQKKSTVYL 336

  Fly   792 IGKEESVKKAREQLEAII--------KECDEVTEGEVSVDPKHHKHFVAKRGFILHRISEECGGV 848
            .|..|||..||:.|...:        ||       ::.|||:           ::.::.|:. .|
Mouse   337 QGTIESVCLARQYLMGCLPLVLMFDMKE-------DIEVDPQ-----------VIAQLMEQL-DV 382

  Fly   849 MISF-PRVGINSDKVTIKG----------AKDCI 871
            .||. |:....|..|.:|.          |:.|:
Mouse   383 FISIKPKPKQPSKSVIVKSVERNALNMYEARKCL 416

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Dp1NP_001286573.1 vigilin_like_KH 170..231 CDD:239087
vigilin_like_KH 242..>290 CDD:239087
vigilin_like_KH 315..373 CDD:239087
vigilin_like_KH 384..440 CDD:239087
vigilin_like_KH 454..513 CDD:239087
vigilin_like_KH 524..586 CDD:239087 6/29 (21%)
vigilin_like_KH 598..659 CDD:239087 21/69 (30%)
vigilin_like_KH 670..732 CDD:239087 21/66 (32%)
vigilin_like_KH 744..806 CDD:239087 25/97 (26%)
vigilin_like_KH 817..879 CDD:239087 13/66 (20%)
vigilin_like_KH 890..989 CDD:239087
vigilin_like_KH 995..1055 CDD:239087
vigilin_like_KH 1075..1137 CDD:239087
vigilin_like_KH 1149..1208 CDD:239087
Bicc1NP_113574.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..43 3/14 (21%)
vigilin_like_KH <80..125 CDD:239087 18/44 (41%)
vigilin_like_KH 136..202 CDD:239087 21/66 (32%)
vigilin_like_KH 288..351 CDD:239087 21/62 (34%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 590..622
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 667..702
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 794..848
SAM_BICC1 875..938 CDD:188919
SAM 878..935 CDD:197735
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.