DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Dp1 and BICC1

DIOPT Version :9

Sequence 1:NP_001286573.1 Gene:Dp1 / 37116 FlyBaseID:FBgn0027835 Length:1301 Species:Drosophila melanogaster
Sequence 2:XP_011538487.1 Gene:BICC1 / 80114 HGNCID:19351 Length:998 Species:Homo sapiens


Alignment Length:432 Identity:106/432 - (24%)
Similarity:169/432 - (39%) Gaps:140/432 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly   560 PTPQENTDIV---KLRGPKEDVDKCHKDLLKLVKEIQE-SSHIIEVPIFKQFH--------KFVI 612
            |.|....|:|   .|..|:...::...|..||...:|: ...::.:|.||...        ....
Human    27 PVPGSEDDLVAGATLHSPEWSEERFRVDRKKLEAMLQDLEVTMLPLPRFKMVRLRPPSWQPAAAE 91

  Fly   613 GKGGAN---IKKIRDETQTKIDLP------AEGDTNEVIVITGKKENVLEAKERIQKIQNELSDI 668
            |||.:.   .:||.:||.|:|..|      |:...:..|.::||||:|.||||.|..:.:..|:.
Human    92 GKGRSGEDFFQKIMEETNTQIAWPSKLKIGAKSKKDPHIKVSGKKEDVKEAKEMIMSVLDTKSNR 156

  Fly   669 VTEEVQIPPKYYNSIIGTGGKLISSIMEECGGVSIKFPNSD-----SKSDKVTIRGPKDDVEKAK 728
            ||.::.:....::.:||.||..|..:|||. |..|.||:|:     .||::|:|.|....||.|:
Human   157 VTLKMDVSHTEHSHVIGKGGNNIKKVMEET-GCHIHFPDSNRNNQAEKSNQVSIAGQPAGVESAR 220

  Fly   729 VQLLEL---------------------------------------ANERQLASFTAEVRAKQ--- 751
            |::.||                                       ....::...|..||..|   
Human   221 VRIRELLPLVLMFELPIAGILQPVPDPNSPSIQHISQTYNISVSFKQRSRMYGATVIVRGSQNNT 285

  Fly   752 --------------------------------QHHKFLIGKNGASIRKIRDATGARIIFPSNEDT 784
                                            |||.|::|:||::|:.|...|||:|.||...:.
Human   286 SAVKEGTAMLLEHLAGSLASAIPVSTQLDIAAQHHLFMMGRNGSNIKHIMQRTGAQIHFPDPSNP 350

  Fly   785 DKE-VITIIGKEESVKKAREQLEAII--------KECDEVTEGEVSVDPKHHKHFVAKRGFILHR 840
            .|: .:.:.|..|||..||:.|...:        ||       |:.|||:    |:|:   ::.:
Human   351 QKKSTVYLQGTIESVCLARQYLMGCLPLVLMFDMKE-------EIEVDPQ----FIAQ---LMEQ 401

  Fly   841 ISEECGGVMISF-PRVGINSDKVTIKG----------AKDCI 871
            :.     |.||. |:....|..|.:|.          |:.|:
Human   402 LD-----VFISIKPKPKQPSKSVIVKSVERNALNMYEARKCL 438

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Dp1NP_001286573.1 vigilin_like_KH 170..231 CDD:239087
vigilin_like_KH 242..>290 CDD:239087
vigilin_like_KH 315..373 CDD:239087
vigilin_like_KH 384..440 CDD:239087
vigilin_like_KH 454..513 CDD:239087
vigilin_like_KH 524..586 CDD:239087 7/28 (25%)
vigilin_like_KH 598..659 CDD:239087 24/77 (31%)
vigilin_like_KH 670..732 CDD:239087 23/66 (35%)
vigilin_like_KH 744..806 CDD:239087 26/97 (27%)
vigilin_like_KH 817..879 CDD:239087 15/66 (23%)
vigilin_like_KH 890..989 CDD:239087
vigilin_like_KH 995..1055 CDD:239087
vigilin_like_KH 1075..1137 CDD:239087
vigilin_like_KH 1149..1208 CDD:239087
BICC1XP_011538487.1 vigilin_like_KH <102..147 CDD:239087 18/44 (41%)
vigilin_like_KH 158..224 CDD:239087 23/66 (35%)
vigilin_like_KH 310..373 CDD:239087 22/62 (35%)
SAM_BICC1 896..960 CDD:188919
SAM 900..957 CDD:197735
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.